ELF>@@@8 @@@@eeppp9 9 (((   0088800hhhDDStd88800PtdPpPpPpQtdRtd(((ee/lib64/ld-linux-x86-64.so.2 GNUGNUo&=,lb$9zGNUs  Gsw|(?3MQ*3/8fUaf-3M98>IJ3M3}* G7 <G#D 4m J_  w s4ac O   \^~ 9h  F"9 i8  0%f ? b v7Y { +s   N J*  | dh/egH_ "    UO RM@ ocm@>  ry" c *)J  !%    )%  3gzX}Cv/ 4Uq 5 oj c I y7 fd% [O a G Kiq v  l +Q5b QgR cK q (OAga'?  3uF,G *nlY4x  (  ;  `  4q  Z, / ]!' S 1( Y4  `e @Pa(_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__cxa_finalize__libc_start_mainfnmatchnvme_create_ctrlnvme_ctrl_set_discovery_ctrlstrcmpnvme_ctrl_set_unique_discovery_ctrl__errno_locationnvmf_add_ctrlnvme_free_ctrlnvme_ctrl_is_unique_discovery_ctrlgetpagesizeposix_memalignnvme_ctrl_identifynvme_disconnect_ctrlstrerrorstderr__fprintf_chknvme_errno_to_string__stack_chk_failperrornvme_mi_admin_identify_partialstrtoulllocaleconvstrlennvme_identify__isoc99_sscanfnvme_subsystem_get_namenvme_ctrl_get_subsystemnvme_ns_get_namescandir64__snprintf_chknvme_nbft_readcallocnvme_first_subsystemnvme_next_subsystemnvme_ctrl_findnvme_ctrl_get_namejson_object_new_objectjson_object_new_stringjson_object_object_addjson_object_to_json_string_ext__printf_chkputcharjson_object_putnvme_init_loggingnvme_get_logging_levelnvmf_get_discovery_wargsnvmf_trtype_strnvme_ctrl_get_transportnvmf_connect_disc_entrynvme_subsystem_get_hostnvme_host_get_hostnqnopendirreaddir64strchr__asprintf_chknvme_read_configclosedirstrtolnvme_ctrl_set_tls_key_identitynvme_ctrl_set_keyringnvme_ctrl_set_tls_keynvmf_register_ctrlnvme_status_to_stringoptindstrncmp__xpg_basename__open64_2fstat64nvme_mi_create_rootnvme_mi_open_mctpnvme_mi_init_ctrlnvme_mi_closenvme_mi_free_rootnvme_init_default_loggingnvmf_default_confignvme_free_treenvme_create_rootnvme_root_set_applicationaccessnvme_root_skip_namespacesnvme_scan_topologynvme_host_get_idsnvme_lookup_hostnvme_host_set_dhchap_keynvme_host_is_pdc_enablednvme_dump_confignvme_scan_ctrlnvme_ctrl_config_matchnvme_ctrl_is_discovery_ctrlnvme_ctrl_get_host_ifacefopen64fgetsstrsepnvme_ctrl_get_host_traddrnvme_nbft_freenvme_first_hostnvme_host_get_hostidnvme_subsystem_first_ctrlnvme_ctrl_get_trsvciddlsymnvme_subsystem_next_ctrlnvme_ctrl_get_traddrfwritenvme_ctrl_get_subsysnqnnvme_ctrl_get_addressnvme_next_hostfclosenvme_parse_urinvme_free_uristrdupnvme_uuid_to_stringnvme_mi_admin_get_lognvme_get_log_pagenvme_get_ana_log_len_from_id_ctrlnvme_mi_admin_get_ana_log_atomicnvme_get_ana_log_atomicfsyncnvme_get_propertymunmapmalloc_usable_sizememcpynvme_get_nsidnvme_io_mgmt_sendnvme_io_mgmt_recvnvme_mi_admin_get_log_pagestdoutnvme_mi_admin_ns_mgmtnvme_ns_mgmtnvme_init_ctrl_listnvme_mi_admin_ns_attachnvme_ns_attachnvme_virtual_mgmtstrsignalfflushnvme_dev_self_testnvme_mi_admin_fw_downloadnvme_fw_downloadnvme_mi_admin_fw_commitnvme_fw_commitnvme_subsystem_resetnvme_ctrl_resetnvme_ns_rescannvme_mi_admin_sanitize_nvmnvme_sanitize_nvmnvme_set_propertynvme_mi_admin_format_nvmioctlnvme_format_nvmnvme_set_featuresnvme_get_feature_length__sprintf_chkmmap64mallocmemsetnvme_read_keynvme_export_tls_key_versionedlocaltimestrftimesetlocalenvme_directive_sendnvme_ionvme_init_dsm_rangenvme_dsmnvme_submit_io_passthrunvme_resv_acquirenvme_resv_registernvme_resv_releasenvme_resv_reportnvme_mi_admin_security_recvnvme_security_receivenvme_get_lba_statusnvme_capacity_mgmtnvme_directive_recvnvme_lockdownnvmf_hostnqn_generatenvmf_hostnqn_from_filenvme_gen_dhchap_keygetrandomnvme_lookup_keyringnvme_describe_key_serialumaskchmodnvme_export_tls_keynvme_insert_tls_key_versionednvme_import_tls_keynvme_generate_tls_key_identitynvme_revoke_tls_keystdinfreopen64strrchrstrcspnnvme_update_keynvme_scan_tls_keysnvme_mi_admin_security_sendnvme_security_sendgettimeofdaynvme_mi_status_to_stringnvme_subsystem_get_nqnnvme_subsystem_get_iopolicynvme_subsystem_get_typenvme_subsystem_first_nsnvme_namespace_first_pathnvme_path_get_ctrlnvme_path_get_ana_statenvme_ctrl_get_statenvme_namespace_next_pathnvme_copynvme_init_copy_rangeexit__vfprintf_chkfputcopen_memstream__assert_fail__strncpy_chknvme_ns_get_lba_sizenvme_ns_get_lba_countnvme_ns_get_lba_utilnvme_ns_get_meta_sizesnprintfnvme_ns_get_firmwarenvme_ns_get_nsidnvme_ns_get_modelnvme_ns_get_serialnvme_ctrl_get_phy_slotnvme_ctrl_get_firmwarenvme_ctrl_get_modelnvme_ctrl_get_serialnvme_ctrl_get_cntlidnvme_ctrl_first_nsnvme_ctrl_next_nsnvme_ctrl_first_pathnvme_path_get_nsnvme_ctrl_next_pathnvme_ns_get_ctrlnvme_subsystem_next_nsnvmf_sectype_strnvmf_subtype_strnvmf_treq_strnvmf_eflags_strnvmf_prtype_strnvmf_qptype_strnvmf_cms_strnvmf_adrfam_strjson_object_new_uint64json_object_new_intjson_object_new_arrayjson_object_array_addstrnlenjson_object_set_serializer__memcpy_chksocketbindsetsockoptacceptnvme_mi_admin_admin_passthrunvme_admin_passthruexeclpnvme_get_versionnvme_init_copy_range_f1nvme_init_copy_range_f2nvme_init_copy_range_f3nvme_get_feature_length2nvme_ctrl_is_persistent__vasprintf_chknvme_ns_get_generic_namenvme_path_get_namejson_object_new_doublenvme_submit_admin_passthrunvme_get_loggetcwdnvme_get_featuresstrncpygmtime__ctype_toupper_localphasort64nvme_namespace_filterstrstrusleepreadlinkpopenpcloserealloc__ctype_b_loc__strcpy_chkdirnamefputs__strcat_chkmkdirrmdirfgetcsysinfofreadnvme_ctrl_get_sysfs_dirnvme_scan_namespacenvme_ns_get_sysfs_dirnvme_free_nsnvme_scanclock_gettimesrandnvme_get_attrnvme_zns_mgmt_sendnvme_zns_mgmt_recv__vsnprintf_chkjson_object_new_string_lengetpass__isoc99_fscanfnvme_zns_appendfseekftellnvme_get_telemetry_lognvme_set_features_host_behaviornvme_get_features_host_behavior__ctype_tolower_locjson_object_new_int64json_object_object_get_exjson_object_getnvme_uuid_findnvme_mi_admin_get_featuresgetopt_long_onlyoptargstrncasecmpstrtoulstrtodstrtokstrtoumaxnvme_submit_passthrunvme_submit_passthru64madvisejson_object_to_json_stringjson_object_get_string_lenjson_object_get_stringprintbuf_memappendnvme_get_ctrl_telemetrynvme_get_new_host_telemetryjson_tokener_newjson_tokener_parse_exjson_tokener_freenvme_get_telemetry_maxjson_object_get_booleanjson_object_get_intjson_tokener_error_descnvme_ns_identifynvme_io_passthrunvme_lookup_subsystemnvme_lookup_ctrlnvme_ctrl_set_dhchap_keynvmf_update_confignvme_update_confignvmf_hostid_from_filenvmf_connect_ctrlgmtime_rjson_object_get_uint64json_object_array_lengthjson_object_array_get_idxjson_object_get_typejson_object_array_del_idxjson_object_array_put_idxtzsetlocaltime_rremove_Unwind_Resume__gcc_personality_v0libnvme.so.1libnvme-mi.so.1libjson-c.so.5libgcc_s.so.1libc.so.6GCC_3.0GCC_3.3.1LIBNVME_1.10LIBNVME_1.9LIBNVME_1_7LIBNVME_1_8LIBNVME_1_3LIBNVME_1_4LIBNVME_1.11LIBNVME_1_6LIBNVME_1_2LIBNVME_1_5LIBNVME_1_0LIBNVME_MI_1_3LIBNVME_MI_1_2LIBNVME_MI_1_4LIBNVME_MI_1_1LIBNVME_MI_1_10JSONC_0.14GLIBC_2.33GLIBC_2.8GLIBC_2.4GLIBC_2.17GLIBC_2.14GLIBC_2.34GLIBC_2.25GLIBC_2.7GLIBC_2.3GLIBC_2.2.5GLIBC_2.3.4                     0P&y a_&  R )K -K 9K EK QK ]R iK vK K K `nnnn 9  ii ii '2=ii Hii Rui \ti h( 08@@xu;.غ:5m8yqXݼxԕPȻ`лػX(;) (P08ٲ@HPX`Xh px7Pͱȼhмؼ`@ (08@HPX`èhpƨx%ɨ̨1qϨ5ҨըaȽ4(@xIHIPIXJ`hJhJpHKxK LPL` ȾLL@M M(0M8N@H` hKpW ctzȿӎƊيǰheX"(<X<hQ;Q|+(8HڋƊيǰheX"(<8H#XhQ;i(8HhڋxˌڌƊيǰXܹ(8 H'XXhAxOfu̺(8Űx}0J8O@OHHPHXN`NhTpTxZZ``ffllrrxx~~ (08@HPX`hpx`` ( >()B06B8CB@PBH]BPkBXyB`BhBpBxBBBBBBCCC,C9CFCSC`CmCzCCCCCC C(C0C8C@CH DPDX#D`1Dh?DpNDx]DkDyDDDDDDDDDDD EE%E2E>EJEVEbE nE(zE0E8E@EHEPEXE`EhEpExEFFF(F4F@FLFXFdFpF|FFFFFFFFGG #G(4G0DG8PG@\GHhGPtGXG`GhGpGxGGGGGGHH'H8HIHZHkH{HHH (0*8E@_HA)Xv`0( (0 8 o@ ;H ( s0 s8 @ sH sP sX t` .th Htp _tx {t t  ) t t t t t u ,u Cu \u uu u u u u u v( v0 8 Ч@ H 1vP  X H` p  Ev Zv  rv v v v v v v w "w 3w 9wSw gw(w08@wH0PXX`hЩpxww ww xx/xCxXxmxxxxx x(x0x@yHyP-yXAy`Uyhkyp~yxyyyyyyzzz1zAzSzezvzzzz z(z0 {8{@*{H>{PQ{Xz`c{hzpzxu{{{{ 3DTfwó=h* #(90O8e@yHP)X*`hpx-Jb~** 7P\hu @ H P  X 0` `p x P  p P     P  P  `   !! !0 !p(!p0!8!@!pH!X!`!h! p!x!!!!@!p!! !! !!! !`""" ""`"`"`" ""E"" "####@ #б(#0#8#P@#p H#P#X#P`#h#p#`x#P## @#@#P#### ###0#####$$?$@$ $`G($p0$@F8$@@$0?P$X$`$ h$Pp$Qx$$P$$@M$p\$$P$p$`$pf$$$$%@%` %@k%  %`(%0%8%@%peH%p!P%X%6`%h%)p%,x%-%`F%+%$%G%J%%%%0 %0/%%%%%`"%&'&%&0&0I & (&p0& 8& @&H& P&X& `& h&p&@x&e&:&0A&&&&&`&&`&&&&&P&&''0'P'`r ' (' 0'8'p@'H'P'`'h' jp'p''Pj'P'_':'z''l''''0g(â(j(  (I((j0(8@(ǢH(jP(`(̢h( kp(p(֢(hk((ߢ(k(0( ((_(((X)+)7)0O )O()k0)E@)`H)kP)=`)oh)|p)=))) =)2) l))),))ţ)Hl)**У* *(*pl0*`@*ݴH*P*@`*h*lp*Ѝ**l*z**m*u*!*+*pH*G*W*C+Q+l+F +(+Hm0+@+H+P+J`+h+hmp+`++m+`+Ť+m++ n+m+p++ n+@,?,Hn, ,Ҥ(,xn0,@,ؤH,nP,``,Ph,np,,ݤ,o,,,8o, ,,ho,P,,o,--o-`+ -(-p0-%@-.H-0pP- `-<h-hpp-l-J-p--V-p- -e-q-P3--q-<-. .Xq.PZ .(.q0.R@.H.qP. W`.#:h.qp.ph..H.Pv.Х.r.q..Pr...r.Д//r/2 /+(/r0/@/9H/ sP/0"`/8h/Xsp/0(/J/s/k/Y/s/e/g/s/a/v/(t/]00Xt0V 0(0t00P@0H0tP0 J`0ɦh0tp0@E0ݦ00u0@)0 0Xu0-0zC00@70001)131 1O(1u01@@1cH1jP1P<`1@h1up11<1u111v111@v111xv122v20 2(2v02@2H2wP2`2h2Hwp22˧2w2 2ӧ2w22ۧ2w2`22 x233Xx3` 3(3x03`@3H3xP3P`3 h3yp30353hy3`3?3y33K3y303U3(z34$4Xz4@ 4](4z04@4H4zP4`4Ch4op4444@44({4`44444`44@44 444434353535`35@3 5 3(53052852@52H52P5`2X5@2`5 2h52p51x5151515`15@15 151505050505`05@05 0505/5/6/6/6`/6@/ 6 /(6/06.86.@6.H6.P6`.X6@.`6 .h6.p6-x6-6-6-6`-6@-6 -6-6,6,6,6,6`,6@,6 ,6,6+6+7+7+7`+7@+ 7 +(7+07*87*@7*H7*P7`*X7@*`7 *h7*p7)x7)7)7)7`)7@)7 )7)7(7(7(7(7`(7@(7 (7(7'7'8'8'8`'884P8 8`8h8@p8بx8X{8 88888*8E8_819$9v(9089H90X91h9x9ه919h199@19191959":R:x(:8:H:oX:h:::::::::;;(;8;H;I^X;I^h;I^x;I^;I^;I^;I^;I^;I^;I^;I^;I^<I^<I^(<8<H<X<h<x<<<<<(<(<(<<)==8) =X)0=*@=BP=P`=np=========>> >0>@>6P>F`>p>Y>j>>>>>>?? ?0?@?P?)`?p????(?9??M?U?n@@ @0@@@`@x)p@)@(@@@)@X)@8)@)@*AA) A*0A@*@Ah*PA*`A*pAAAA:AOAlAAABB* B0B@B+PB`BpBBB(B(BFBBBBBCYC C0+0CP+@CPC`CYpCjCDDh"EEp+(FF+@GHGPGXG`G hG`pGxGGGGGGGGGGGGGGGGGHHHH H(H0H8H@HHHФPHXHX`HhHpHpxHHH@Mz`MpMHMzNNz(NzHNXNzN{N{N{N{N{N~N{O{O{ O|(O|8O7|@OB|PO^|XOl|hO|pO|O|OpO|OO|OȪO|OO|O|O}PP}PH(P }0Px@P(}HPpP2}xPPJ}PPc}PHP^|Pl|P|P|P|PpQ|QQx} Qx0Q}8QHQ}PQ`Q}hQxQ}QHQ }QxQ(}QQ}Q}R} R}8R}PR}hR}R}RdR~R~R ~R~@S{HS{XS|`S|pS7|xSB|S~SS&~SS5~S@SA~S@T| Tp0TN~8TTb~TxTs~TT~T~PU}XUhU}pUHV~V~(V~@V7|HVB|XV~`V~pV~V~V VxW{W{W|W|W7|WB|W5W-WAWAWKWVXbXȭ Xq(X8X@X8PXXX`hXpXXXXXXXYY Y80Y`@YPY)`YpYYY:Y?YPYnYYYMZbZv Z0Z&=@ZPZE`ZpZZZZZZ@ZZZ6[F[?@ [Z@0[@[P[Y`[+ [[`[[[[E[[\*\ \#0\8@\2P\E`\p\0\X\\"\7\L\a\v\]] ]0]@]P]H`]]V]d]E]]+ ]x]r]^^ ^0^@^P^`^p^^^^^3^J^a^x^__ _0_@_P_`_4p_L_d_|______`` `#0`5@`HP`Z``mp`````````a+a> aR0ae@ayPa`apaaaaaaaaa b!bE b/0b@bPb`bpb0bb`bbb!bEb/bcc c0c0@cPc`cpc@cc c c% c; c c c c@ c` c d0 d d! d3 d` (d 0d 8d @d Hd `d dЭ d dP d d ddddddddeeee" e%(e(0e,8e0@e6He Pe `e6heppep e7e7e e%7ee e97eXe` eO7ek7e` f7f7f f7(f70f[ @f7HfXPf0 `f8hf&8pfP fD8fb8f@a f8f8f f8f8f] f8fYf gY;g@Yg g';(ghY0g @gC9HgYPg` `g 9hgYpgP g(9gYgPS g=9gZg0 gyg8Zgh gW9gs9gP3 hp;h9h h=(hhZ0hP @h9HhZPh `h9hh9ph huh9h hzhZh h9hZh hݴh[h h i9i8[i@ in(i`[0i0$ @i )Hi[Pi` `i%'hi[pi@{ ini[i0 i:i\iF i3)iH\i i:i":i { j<:jF:jB j]:(ji:0jz @j:Hj:Pjz `j:hj:pj{ jmjx\j jj\jr jCj\j`! jj0]j@ k9kp]k# kW9(k]0k@9 @k:Hk]Pk@ `k:hk]pkm k:k:k` k ;k^k - k#;k8^k k<;kh^k lU;l^lp ll;(l^0lЛ @l;Hl;PlY `l;hl;pl ll;l l;l <lk l&<l4<l`` lG<lX<lp mr<m<m m<(m^0m` @m^Hm_Pm `m<hm<pm`/ m=9m<m m<m=m m.=m;=m@ mL=m^=m nt=n=n n=(n=0n0 @n 9HnP_Pn `n=hn=pn n=n=n I nyn >n> n&>n4>n`c nF>nL>na oCoV>o` on>(o}>0o[ @o>Ho>PoZ `o>ho>poPV o>o>o< o>ox_o o>o_o o ?o?o p-?p9?pк p 9(p`0p @pyHpP?Ppм `p=hpa?pp p|?p(pЮ p?p?p@ p&<p?p0 p?p`p qr<q?q q<(qa0q @q=9Hq@aPq `qahqapq q@q@q q1@qaq qF@qQ@q qe@qbqp ryry@r` r=(r0b0r @r9Hr@PrP `rChropr@ rCrpbr0 r@rbr r@rbr r9rbr` s;scs@ s;(s0c0s@s=9Hs`cPs `s<hscpsЄ syscs s@sdsЙ s@s8dsP s 9shdsЏ t;tdt H t=(td0tk @t@HtdPtV `t;ht ept@ t AtPet@P tAtet4 t8t!At " t#:t/AtP. u9u=Au) u$9(uUA0u0% @u7HuePu@ `uqAhuepu0 u9u(fu@uCuou0u{AuAu@uAuAuvAvPfvt vA(vxf0v8@v=9Hv Pv`D`v=hvApvWvAvfvp3vAvfvevBvfvp=v<vBv,wr<w?w@6 w;(w3B0w @w;Hw3BPw `w&<hwOBpw@RwjBw{Bw`w=wBww^w gw\wywBwx 9xBxpI x;(xXg0x@x;HxgPx@F`xBhxBpx&x CxgxxCxgxx.Cx x x@CxgxpyRCy(hy ydC(yXh0y@ytCHyCPyZ`yChyhpypyզyCyPyCyhyyqAyhyyByByzCzizW zC(z0i0z@z9HzXhPz`z?hzXipz zz9ziz}zCzizxzCzizz Dzjz {qA{Hj{0 {y({j0{@{CH{oP{^`{!Dh{jp{d{1D{;D{0{JD{WD{@_{C{eD{]{{j{|D|D| |4(|D0|@|H|kP|T`|h|0kp|H|@|D|@F|D|hk|B|`|D|>|9|k|8|}C}o} }9(}k0}@}CH}oP}`} hh}hp}gx}g}g}g}`g}@g} g}g}f}f}f}f}`f}@f} f}f}e}e~e~e~`e~@e@~hH~hP~hX~h`~`hh~@h~i~j~j~j~j~`j~@j~ j~j~i~i~i~i`i@i i k@oH`oP@oX o`ohnpnxnn`n@n nnmmmm`m@m mmllll`l@l l l(k0k8k@kH`kP@kX kpoxopo`pȀ@pЀ p`r@r rrqqqq `q(@q0 q8q@pHpPpXprrrr`tȁ@tЁ t؁tssss`s@s ss@uH`uP@uX u`uhtptxttuuuv`x@x xxwwww `w(@w0 w8w@vHvPvXv``vh@vp v@z zzyyyy`y@yȃ yЃy؃xxxx@{ {{z z(z0z8`zP`{`{h{{{|||`|@|Ȅ |Є||} }@} D(D0 E8`}`hEpjx@~$Ekj~*E.Ej~ JE(l0j8 `OEh lpSEx@ZEPljpbExlj lE(tE0j8`EhlpExEljElj E(m0j8@`Eh@mpjxEhmjEj E(m0j8`EhmpjxEmjEnjP E(0n0j8``EhXnpjxEnjFnj F(n0j8` FhnpjxFojERWeh 8s}x {(hpx      (08@HPX` h!p"x#$%&'()*+,-./01234567 9(:0;8<@=H>P?X@`AhBpCxDEFGHIJKLMNOPQRSTUVWX Y(Z0[8\@]H^P_X``ahbpcxdefghijklmnopqrstuvwx y(z0{8|@}H~PX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx      (08@H P!X"`#h$p%x&'()*+,-./0123456789: ;(<0=8>@?H@PAXB`ChDpExFGHIJKLMNOPQSTUVXYZ[\ ](^0_8`@aHbPcXd`fhgpixjklmnopqrHHٯHtH52%3hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjA%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݌D%ՌD%͌D%ŌD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݋D%ՋD%͋D%ŋD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݊D%ՊD%͊D%ŊD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݉D%ՉD%͉D%ʼnD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݈D%ՈD%͈D%ňD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݇D%ՇD%͇D%ŇD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݆D%ՆD%͆D%ņD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݅D%ՅD%ͅD%ŅD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݄D%ՄD%̈́D%ńD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݃D%ՃD%̓D%ŃD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D%%D%D%D% D%D%D%D%D%D%݂D%ՂD%͂D%łD%D%D%D%D%D%D%D%D%}D%uD%mD%eD%]D%UD%MD%ED%=D%5D%-D1HVL.1HBLE111LHD$&HHH|$E1E1E11E11E11E1E1E1E11E1 HLHXH`H~HHHDžHuHtHE1L2H*HH:HH|$Ht 1quHHH|$E1LLH|$Ht@uHE1E1HA~DH|$Ht uH|$HHHHÐHL}HUH|$Ht E1tLIH|$H|$HttHHL-HH|$Ht E1ctLIH|$H|$Ht E1BtLILHH|$HIHLH|$Ht 1sHHH|$IHL\H|$Ht 1sHHH|$HHLH$H|$Ht 1sHHH|$E1E1LLH|$ HtOsHE1ԐHLR~ HH1Lt$@H|$ Ht s1Lt$@H|$ E1LLH|$ HtrH`E1E11HnH|$HtrL711111͐HL3H H|$Ht E1irLIH|$IH|$HH|$ Ht1rL1A~DHH|$HtrHHL1HH1111HIHIHaL9H|$Ht 1qHHH|$H|$qHHH!LIH|$Ht1A~DDLH|$Ht-qHE1HE1LH|$HtpHHA~D1HH|$HtpLK1111ѐHHKH#H|$Ht 1pHHH|$HHHH|$Ht 1JpHHH|$HHHH|$Ht 1pHHH|$1H|$HtoHLrH|$1IܐIHnLFH|$Ht 1oHHH|$E1L;H|$Ht|oHE1H|$eoHHHLIH|$Ht1H|$Ht)oHH|$1H<$Ht oHH1H1H<$11E1E111LyLqH|$8HtnHZHRL*E11E1E11IE1LHE1E1E11H|$HtMnHHH11H|$HtnHLI11H|$HtmHLqI11H|$HtmHkLCI11E1H|$HtmH:L2H 1E1HE11E1H|$HtQmHLHH1H|$HtmHHHE1LH|$HtlHt1HH|$HtlLS1H|$HtlHZL2I11H|$HtlH,H1H1АIHL1H|$Ht:l1H|$Ht'lHLI1H|$HtkLH|$HtkLlHH|HT1H|$Htk1H}TLLH$LHD$(0HD$("HD$(HD$(HD$(HD$(HD$(HD$(HD$(HD$(HD$(HD$(HD$(HD$(zHD$(lHD$(^HD$(PHD$(BHD$(4HD$(&HD$(H|$"HH|$HH|$HH<$H1HL1H|$HtaLH|$Ht`HH|$Ht`HjH|$Ht`LSHPHt`H:H|$Ht`H#HHt`H HHti`HHHtP`HH|$Ht9`HH|$Ht"`HH|$Ht `HH|$Ht_H|HHt_HcHYHt_HJLj H:H<$j H)H|$ j HLj HA~DiH~ULH|$Ht>_HH|$XHH|$H|$HHDžHHHt^HhHDžHDžALbA~DHHt^HE1AHE1AAH|$Ht[^HE1L$L`i LH|$hHt)^HE1L$H|$Ht^HH|$Ht]HvH|$Ht]H_H|$(Ht]HHHPL8H|$NH&HL6HE1H|$Htl]E1E1L A~DL~ 8HHt']H;h HDE1E1HE1HHDžE1AjE1LQHIE1E1E1E1E1L.LFL>HHE1E1LHE1HDž MtLHH@H8HHHHHG H:HP0Hz(Hx0ff.fUH SHHHH ~>HH5H{HuÃt1H[]H=J1H=:HH=! d]wHHwH= HfDAUIATUHSHHHIHSs(LK LCH3ZYIHtcHǾH;H5 1L@ =]$t@uE$`HLL]$u%HL[]A\A]~E$LE1eAWIAVIAUIATUSHH(dH%(HD$1IHH1t7HoHD$dH+%(BH(L[]A\A]A^A_f{H|$HcIHl$1H}HHEHHDžHH)HLunHH5 HHD$CDLLKHD$LHLLIEIf1E1fD8AH=H1H, LGLE1;IIIAWAAVIAUIATUSHHdH%(HD$1HHct=1AHHD$dH+%(FHD[]A\A]A^A_H,$A1H}HHEHDžHH)HAw.AAuNC HHH IE[Au*HL蟿u[@CfDH5 1A C fC}H= TD AH5 AH5i 1>IfAUIATIHUSHH%Q Ht`LH‰HM AąuImHD[]A\A]H#څDEH[]DA\A]fD H[]ADA\A]AWfAVAUIATUSHHt$ L$LD$DL$(dH%(H$1x_)D$p)$)$DŽ$0$DŽ$HIHD$H_I8H|$XLcLu_Hl$XH}HHEHHDžHHD$H)HLMAąxhyE11fE111ALkHcH[H$dH+%(OHĸD[]A\A]A^A_s8`HH5.+ 1:lDH|$`LH\$`1H{HHHǃHH)HH\$xueAjI~Ht$p1|AąDE1@E11AAH|$hL8t$E1AfDfDL|$h1DILILILJHH)HL?Aąt8M 11E1@D#Nt$Lt$PL0 1HH AtA@t$LfD$.?H|$PII9H?Ht$ML?L$(L1HHt)IL?`L$T$.MHt$ L1HcHH1@8]HH5 1DLD$0LD$0LMGLLD$8LT$0kH|$PLT$0D$@LD$8=DXE1HfB4HQDH H  @8H9u@t}C:4 uwAIIQM9IA8HH5 12fDH|$8HD$0LD$0H|$88"JHT$ L1H58 MD AKfDAFH|$p$H|$PD$@E1H7@H AQHfDLH EA8H9uLcL$@1LHL$HLD$8ILLL$PLL$0H|$PLL$0LD$8HL$HHD$I9H|$0DEt D)1QA8ubHHHL1҅KHI9u9)Ht$1fDH4H9uIHt$I HH B|XD1cH1H50 E111A9fHT$)1IfDHЃIH9uI4E+LL$HH|$@LD$8HL$0gHL$0LD$88"H|$@LL$HLcB47E1Hzff.AVAUATUH(dH%(HD$1H9H͸u#HT$dH+%(H(]A\A]A^III1HL$HT$ HH5D Mt#LHT$H5' H1xt[Mt+LH~HT$H5 H1HtK1MMLpHH0D$ 9D$ufDfDD$ 9D$u'AWAVAUATUSHH $H81H9dH%(H$(1IIHt$LsHHl$ L|$1HL52HD$DHD$H<HH9\$twHHMHD$ MHHP1VXHZLuHT$L(HPIUHPHIEvfDH|$1H$(dH+%(u$H8[]A\A]A^A_#ATIUSH}HtPHHLuHHt5Hs HK(HHSHsLKLZYHt[]A\[1]A\ÐAWMAVMAUIATIUHLSHHH(dH%(HD$D$D$D$CHt6HHt)1HT$dH+%(H([]A\A]A^A_@HIOIWAw(MGLMO I7_AXIHH$Ht$hAt EMt A<$H$LLHDD$ +DD$ t E#D$`n|$`LHHHt HHHH5HdH5H1螹 H<Mt A<$PH$LLHXELH$[f.A$tAFTH$LLHL$hAfL$t$LD$ T$vD$ DHT$Ht$LDD$ 11ҾLD$D$IHD$P@A~HD$XIHD$`HEHD$hHE HD$pIF HD$xtLL"HHtHtA>H|$HD$Ht$H'GA~$MLM1LP$PH|$0^_A=ED$AD$$DIL51H$dH+%(HĘ[]A\A]A^A_f.1LLLMMLIË$LP$PHt$0H|$8L\$ AXAYH|$H|$EMH|$XH5 HD$(H@HD$hM1LHD$hMLHD$$P$PH|$0ZYAuc$HD$(LD$H H=11xHD$(H=H 1OwHD$(DD$H\ H=ݹ1$DD$ABLt$NӴ8HÁ2IHD$(H=H 1_I5DAWAVAUIATIUHSHDL$,DD$+dH%(H$1RH*H|$`Ll$`HD$H HD$hHD$pD$xD$|H8IH@H$MBL1ŅH$LH Hcζ6LH5 10L11H$dH+%(H[]A\A]A^A_fDH<$tH$L|$@E1IHD$ HD$_HD$8D$+Ll$0D$LE$;D$_L{ LLD$L$H|$Ht$ L$H$HEL$H$HEH$HHt0Ht&IHL9$$lL|$@;0H|$0HD$aHt$HtuC<)S T$uH5 LET$D$+D$K=.E$~ E$f۱H|$HHHL$8HD$LD$HNjD$HE$+|$_|$KH|$CH|$ɾ@k8dH==LH I1t|$,HH@8H4$L@D$KfD8H=ŵLH I1>軰8HÁ襳HH={H 1A8=;&H|$HD$AWMAVLL$ H1H= H; NXZ(E$@fЃD$K@DL$,DD$L1HH|$BH|$ {HNff.AWAVL5 AUATUSH(H|$LdH%(HD$1HHAL|$L-*@HpHt{xuHX.HTHtHpL3uILH(LxaHt$H|$RH|$DEmHHuHXHD$dH+%(u H(D[]A\A]A^A_fDA#Aff.AVMAUIATUHSHHdH%(HD$1Ht1HIrL9$$tTHC8Mt LL訮Ht1HHFH9,$t8HC@HD$dH+%(u1H[]A\A]A^LL}HL蝺VfDAUIՉATSHdH%(HD$1HL$H HT$MLDtwþxL7MLH PSDL$H= 1PXZHD$dH+%(uIH[A\A]@HAMPLHN @LLH5a 1gpAWAAVIAUAATUHSH(Lc%dH%(HD$1膬HE94O4H5 L蜰Aą貳IHLnLDI$;DžA$AD$Ml$LAD$(%= LeE1f.L|$Ll$1LLD$LLH5N t(1LLLH5B D$βIHH=%LIEHH T$t$覬IEHHt$,IEHLmHD$dH+%()H(D[]A\A]A^A_DLH5 1A$A|$L6D#AfDLH5: 1RL(fDLI>ABI}tI} L÷H=A<1H h H H=AK1H 7 H YfAWIAVIAUMATILULLH1& tH]A\A]A^A_5*BH=+FC11҉5X苬1LL\yLLD$ )% D$ H]A\A]A^A_HtfUHSHH5;Ht;H5?$Ht0H5aHٸu*1H[]D1@ø@UHAWAVAUATSHH $HH $HHH HI1ALzLPLH57dH%(HEHc ƅ&HDžHDžHDžHDžHDžHH HhH HHH H8HHLH HDžHHH HH HDžHDžxHDžpHDž`HDžXHDžPDž(HDž@ƅ%ƅ$ƅtHDžDžH H H8HHXH HhH HHHH HH HHHHi HH HH H@H HXHXƅ@nHHDžPDž`ƅaHDžDžƅsHDžDžƅwH Dž(L0Dž8ƅ`fHhDžpHxH HH HHHH HH HHHHx HH H0HHPH~ H`H HxHHH HHi HHxDžƅqHDžDžƅIHDžDžƅ8SH@DžHDžXHDžDžHDžHH HH HHpH(H H8H HPHdHpH HH HHxHH HH HH|HH HHd H(H`DžHDž Dž0ƅXiH`DžhDžxƅWHDžDžƅPHDžDžƅ0QH8Dž@HHHQ HXH HpHtHH_ HH HHhHH] HHm HHlH H[ H0HQ HHHpHhHa HxH8 HHDžPƅxkHDžDžƅcHDžDžƅlHDžDž(ƅPFHXDž`DžpƅTHH HH HHHHu HH H HH@Hr HPHg HhHHH HHL HHHH HH- HHHH H(HuH@HH`H HpH HHHH HHbHDžDžHDžDžƅ(DƅgƅGHH HH@HH HHj HH5s HH\ HH5& H(HHHH5AH8H HH5 HHH+HH5 H`H HH5ۣHpHH5 HHHhH H5JHXH ƅdDžDžƅ oDž0Dž@ƅhrDžxDžƅpH8ƅ@JDžPDž`HhH> HH(HH* HH7 HHۢHH@ HH HH&H0H> H@H HXH%HxH HH HH$HH HH HH8HH HH H0HPHPH ƅvHDž ƅOHDžDžH@DžHDžXH`赲HLLD  AE1tFLާHXH`HEdH+%(HeD[A\A]A^A_]ÐHHH, AŅjL5 HhL u HDžh(H=FC=ΠE5 IHaHPHtH腛Lh1L W؅LLDЈ#11LAŅHHLH`LXhHXH`LdHHL@MLLɪH5 L轞u IL@HHL@fLLŝƅ+D(A8-H=H1H fDHDž@HHHYL@MHLHHHHPHHHHXH&LHMHHVHHLLHHQD1D,LHHY= AuH1wHoH=ŝDLҢ7DH5T 1eE1D=H LG H@LDH=!H 1^_H&HHHHH"AL@LHMHHH5 LHħHAHm Et(H5 L蟧HHI HEHf.HXt#8HÁ2 H=H1H5 D+AD諢fDLL%HHQHXLPHLHHHZYuH@H=PH 菩HgHPx HXDb+H DHL$0H HT$@H HL$XH EHD$ HT$hHL HL$xH 8 H$H%H$Hz H$HH$H@ Hl$D$vD$( D$`oD$pDŽ$Ƅ$tDŽ$DŽ$H$ AE1t9LIH$8dH+%(NHHD[]A\A]A^A_D5ZH=[zFC11҉5zxHcHL$HDL荕AąHt$HT$L0H= Hl$HD$ApAH5B 1^AH lV^OA*jHv3vH,v1vHuAV1AHAUH5ATUSHHdH%(H$1H$fL$ -HD$L$HH$H|$HP H$H Hĉ H$H H Ō H$H7 H$H H$H59 H$H H$0HL$ H$H$@H$PH  H$`DƄ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8gDŽ$HDŽ$XH$xƄ$tH$HYH$H DŽ$DŽ$H$諲Hl$AE1tdHt*E\uH}ncH}nHiLiH$dH+%(HHD[]A\A]A^H=Ht$ ײAąDpH|$Hcu`Ll$1I}LIEIDžHH)HET$ H}fHt$`H )D$p)$)$Ll$pD$x@H$f$)D$`]aAą~@艐@AD}pHphAfZ8]HH5 1rADH5D 1UE1!D}fT$TH HT$ Ll$0HD$ HD$(D$8@|$BIHZ@H H HD$ATUHdH%(H$1H$L$HD$D$ HH 7tfA}TL/Lf.Af.[>8HAHH5 1"+D|$M\$ oH H8HLHf.A}fT$TH HT$ Hl$0HD$ HD$(D$8@|$8t1A1DHl$(1Lt$@H}HHEHDžHH)HHLt$4.AąD$4<|$8<uD$4Lt$@L IHt$4T$8HL-AątcD5hdI}Lt$@9I}iDb@A}Lt$@bHKD<HED$8jt$4HL;-AąxttfA9tZID$4|$\$8HL$D$cHH(Ht$HL$L184HH5;b 1rQDH5D^ 1U12fDLt$@f;18),4HH5a 1Lt$@@<ՐH={ Lt$@Bf.<>fDH={ Lt$@oBAH={ SBAlC=MJH\JHhJHeJH?Jf.AW1AHAVH5!n AUATUSHHdH%(H$1H$fL$8?HD$ L$HD$0HH$HL$0H] H$H[ H \ H$H[ H|$ H$HfH$H)b H$(HY_ H$8H5z H$pHL$8H$H$PH\^ H$`Ƅ$vDŽ$ Ƅ$oDŽ$ DŽ$0Ƅ$XeDŽ$hDŽ$xH$H5] H$HL$9H$H5_ H$H \ H$8HH$H\ H$DH$(H z H$HHp Ƅ$rH$Ƅ$bƄ$0tDŽ$@DŽ$PH$X芄Hl$ AątnE1E1L;L;Ht#EH;H$dH+%(HD[]A\A]A^A_@H=yHt$评Aą|$9tD$H|$0dBH|$(Hc22tE1E1A5DLl$(1I}LIELIDžHH)HHi$Aą.HT$0ATH9HG|HD$0I蓶 IHET$8WH}fH$HDŽ$$$$HDŽ$L$DŽ$@DŽ$D$$2Aą~Oa H}g3H}=H9!}AH9 Af+8].HH5w 1yDH|$H\$0HL$n]HH@HHHL$DHLK}T$xHHT$@Lt$PHD$@HD$HD$X@|$\HD$`D|$hD$lHD$pD$y/H5W 1x*8A-HH5 1xE1fDL@8L88K6f;6H5q 1CxE1E1A*H5\Z 1xE1A A6H DH)DHCHCHDHCHCHCAWA-HAVH5nAUATUHdH%(H$1H|$ D$LD$ HD$HH W Ht$@HU HL$PH fU H5QU HL$xH g H=>X HD$ H[ Ht$hH5H$HL$HD$0H$H5X H$H V H$HH$DH$H|$H$H t D$(vD$8 D$poDŽ$DŽ$Ƅ$rƄ$tDŽ$H$Hsj DŽ$ H$(~Ll$A1t]H5MtAEL5H$dH+%(HĐD]A\A]A^A_H=Ht$~AąHL$L蝨 Aą"|$C HH^t$T$HLc AątL\f.I}.I}9fA}=f|$MDt$XHHHLDHfH5S 1t1fDI\1uf&8i)HH5HW 1ftDk&8A\)HH5W 16t1H3 1땐1A2I5@I+@I>@I6@I.@I&@I@DAVA$HAUH5\S ATUHdH%(H$1H$L$HD$HH .HQ H$H$H SQ H|$H5UQ H$HW H$H ޽H$H$H5b H$H R H$@HH$DH$0H q H$PHf Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8tDŽ$HDŽ$XH$`zHl$AE1teHt*E]uH}w+H}6H1L1H$dH+%(QHD]A\A]A^DH=Ht$ zAąL8H|$Hc}(Ll$1I}LIEIDžHH)HEH}fHt$`H@)D$p)$Ll$pD$x@DŽ$H$)D$`)$g)Aą~JXfDAD}8Hx0Af."8%HH5lS 1rp8DH5DO 1UpE1D}HT$ HHD$@H@HD$H1HD$ HD$(Ll$0D$8@|$M H$HM H|$ H$HHD$@HaS H$HQ H$H5Q H$H L HD$PH$HaO H$D$HvD$X Ƅ$oDŽ$DŽ$Ƅ$sDŽ$DŽ$H$H5vm H$(HL$8H$pH޸H$HM H$8H dm H$HDH$Ha Ƅ$ fDŽ$0DŽ$@H$`Ƅ$htDŽ$xDŽ$H$uLl$ A1tcH|$-H -MtAEL,H$dH+%(ZHD[]A\A]A^A_H=ѷHt$vAąHl$8HD$0AH12Aƅr3H|$(Hck#3Hl$(1H}HHEHDžHH)HHLt$0Z Aą]AI HD$HH0Ct$0L‰D$ 0rSHD$LDHp 9H ""H=k 3fA;D3.fI}$I}n/:fA}g3#f1AfDR;84 HT$8H5 b H1 kE1_H5I 1j1fDHT$8H5N 1pI|$Ht$NHH@HT$Ht$H|${8QlHH5M 1FjfK81<HH5QM 1jq'f'H5M 1i1A{A+H5` 1iq(c6I6Iw6Ik6Ic6IS6IG6AW1AHAVH5)AUATUSH$HdH%(H$1H|$ fL$6HD$LD$ D$ HH\$@HL$ HH H\$PH G H9G H\$hHG H|$HD$ HnM H\$xHX H$H5K H$H K HD$0H$H7 H$H5K H$D$(vD$8 D$poDŽ$DŽ$Ƅ$sDŽ$DŽ$H$HL$H$H$H G H$PHڲH$(DH$@H h H$`H[ H$Ƅ$cDŽ$DŽ$ Ƅ$HtDŽ$XDŽ$hH$poLl$A1tVMtAEL'H&H$dH+%(HD[]A\A]A^A_H=Ht$pAą\$ ؃<؃ < G-H|$HctAAHl$1ށH}HHEIHDžHH)H@LT$oAątMfDDe}EH%%LIڡ M9LHIFHHB!H%T$IDt$ LAąDiMHKI}I})MfA}-6f8xHH5H 1ReDEEE$M@|$l$IH`H@HSHFH5C 1d1xfD8)HH5DH 1df{"fk" H5G 1nd1AH5pG 1KdۺH5d 11d"I1I21I*1I#1I0I1I1I1I0I0I0fDAU1AHATH5qUH`dH%(H$X1H$fL$ 6D$L$HD$HH uA H$H5C H$H S HwA H$H53A H=gC H$HL$ H$H5ŭH$PH }F H$HyG H$H5UF H$`HL$H$H$0H5D H$@H$xH|$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8dDŽ$HDŽ$XƄ$bH$H B H$HH$DH$H b H$HV Ƅ$tDŽ$DŽ$H$&jLl$A1thMt+AEguI}I}%L8!H0!H$XdH+%(SH`D]A\A]fH=Ht$OjAą|$tD$(H|$Hct1AEDHl$1H}HHEHDžHH)HAET$  I}fHt$`H)D$p)$)$Hl$pD$x@H$f$)D$`Aątx~>GfA}7(Lf.Af. 8HH5C 1_%D|$CHHHH@A}fT$THHT$ Hl$0HD$ HD$(D$8@|$ 1_1nfDL,IS,I`,AU1AHATH5UH`dH%(H$X1H$fL$ 6D$L$HD$HH < H$H5C> H$H VN H< H$H5s< H=> H$HL$ H$H5H$PH A H$HB H$H5A H$`HL$H$H$0H5#@ H$@H$xH|$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8dDŽ$HDŽ$XƄ$bH$H I= H$H6H$DH$H H^ H$HQQ Ƅ$tDŽ$DŽ$H$feLl$A1thMt+AEguI})I} LxHpH$XdH+%(#H`D]A\A]fH=YHt$eAą|$tD$P#H|$Hct1AEDHl$1H}HHEHDžHH)HAET$ I}fHt$`H)D$p)$)$Hl$pD$x@H$f$)D$`AątX~>'CfA}w#Lf.Af.H=\ G|$?H3HH#H@A}fT$THHT$ Hl$0HD$ HD$(D$8@|$ H$HL$H$H5+= HD$`H$H$(H5D$XvD$h Ƅ$oDŽ$DŽ$Ƅ$nDŽ$L$DŽ$Ƅ$0sH$HH < H$XH 6 H$pHL$H$H 6 H$HL$H$H==Z H$HL$ H$8H$H$H5*H$H=B8 H$H$ H Z H$XHH$DH$0H < H$HH|$H$hH&L DŽ$@DŽ$PƄ$xmDŽ$DŽ$Ƅ$dDŽ$DŽ$Ƅ$lDŽ$DŽ$(Ƅ$PtDŽ$`DŽ$pH$x_Hl$AąKL$u!UK}LM Aą|$ E1H|$H11AƅT$ LAąELl$0D$8 ED$A~gDl]f.T$ L1E1Wf. IH AH=': @E1LHt&EtauH};H}HH$dH+%(HD]A\A]A^ÐH=9 t%}fDL$T$1H5mW DD$H=B$H|$9D A!H= AS1H @g H@ 70H= A61H g H@ wHi"H""Hu"Hi"H]"fAVAHQAUH5>fATUHdH%(H$1H|$PLl$HD$HD$ LD$P)D$HHt$pH53 HY2 H$H52 H C H$H5 2 H=7 H$H5H$H5HD$PHU8 H$HL$H$H5U HD$`H$H$H5`7 H$(H=1 D$XvD$h Ƅ$oDŽ$DŽ$Ƅ$nDŽ$L$DŽ$Ƅ$0sH$HH 6 H$XH @0 H$pHL$H$H }H$HL$H$H5T H$H gH$8H$H$H=WT H$H5`2 H$HL$ H$H$XH8H$ H y6 H$0H|$H$HDH$hHFF DŽ$@DŽ$PƄ$xmDŽ$DŽ$Ƅ$dDŽ$DŽ$Ƅ$lDŽ$DŽ$(Ƅ$PtDŽ$`DŽ$pH$xYHl$AąL$u!U]}LmAąz|$ E1ELl$0D$8 ED$a H: EH=A1H a H: u HHHHHAV1AHAUH5, ATUSHFHPdH%(H$H1H$fL$*D$L$HD$D$HD$HD$ HHL$D$(HN, H$H- H=P H$H+ H$HH$H]2 H$H5= H$H}H$H$H5- D$,D$0D$4Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$H$H1 H$0HL$H$@H5l1 H$xHL$H$XHn1 H$H5g1 H$HL$H$Hf1 H$H5?O H$HL$ H$H?1 H$H541 H$PHL$(H$ H$hH$H$H$0HJ/ H$@H5?/ Ƅ$nDŽ$(DŽ$8Ƅ$`iDŽ$pDŽ$Ƅ$lDŽ$DŽ$Ƅ$aDŽ$DŽ$Ƅ$8LDŽ$HDŽ$XH$HL$*H$HL$,H$`H=00 H$xHN H$H5, H$(HL$-H$H=k, H$H/ H$H5/ H$pHL$.H$8H=l+ H$PH/ H$H5D H$HL$/H$H$H$`H$H=a0 H$HD H$H5{/ Ƅ$sDŽ$DŽ$Ƅ$SDŽ$DŽ$Ƅ$rƄ$XUDŽ$hDŽ$xƄ$bƄ$yH$H$HL$0H$HH . H$H=. H$pHL$4H$H$HH$(H) H$XDH$H $M H$H|$H$H= DŽ$DŽ$Ƅ$0OƄ$xxDŽ$DŽ$H$Ƅ$tDŽ$DŽ$H$QLl$AąD$u|$@|$(|$-D$4UJ腄 HHnHD$ ft$4HD$xD$XHD$@D$D$HD$dD$Hl$PD$hD$D$X@D$lD$/D$pD$*fD$tD$(D$vD$-D$wD$,D$xD$0D$yAEJI}HT$@Aą|$.Dt$Et$HIfD;H5~HI9uHxAEuI}I} LM2D$D$1HMuH$HdH+%(<HPD[]A\A]A^~d.DA}HT$@DL$I1H5[K DD$t$H蠄 eA83HH5) 1F-A}f[fH5J 1]F1AH5AJ 1=FAH5@+ 1FH5=+ 1FI)I>I6I.IIfAV1AHAUH5# L5# ATUSHoHdH%(H$1H$fL$ ?HD$D$ HH$HL$ H % H$HR# H) H$HH|$H$H54 H$H& H$PH P% H$H5% H$0HS& H$xHL$ H$H$`H5% H$HL$ L$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8rƄ$HH$H($ H$H % H$H$H$HIH$DH$H H H$(H8 Ƅ$bƄ$tDŽ$ DŽ$0H$8LLl$A1teMt+AEuI}I}uL-H%H$dH+%(HĠD[]A\A]A^H=Ht$ GLAąl|$ tD$ |$ ZL$  H|$Hct1A8DHl$1H}HHEHDžHH)HAET$ +I}fHt$`H)D$p)$)$Hl$pD$x@DŽ$H$$)D$`Aą+~8)o@A} LfAf.8=HH5' 1ADH$HufDH{HHHHLu{8gg@A}HT$XHD$@HT$ HHD$ HD$(Hl$0D$8@|$HXH.LHfH5 1@1fDkAHHAVA-HAUH5 L5 ATUSHHdH%(H$1H$D$ HD$HH$H|$H H$H  H H$H/ Hs$ H$HL$ H$H H$H$H5 H$PH ! H$xH$H$HLIH$0DH$`H D L$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8HƄ$tDŽ$H$H3 DŽ$H$8GLl$A1tjMt+AEauI}I}LJHBH$dH+%(HD[]A\A]A^H=)Ht$ _GAą4|$ AL$ H|$Hct1AB@Hl$1H}HHEHDžHH)HAEI}fHt$`H)D$p)$Hl$pD$x@H$)D$`)$Aą"~7%A}OLfAf.+8-HH5X" 1<3DH$HufDH{HHHHLu{8@A}HT$ HHD$@1HD$ HD$(Hl$0D$8@|$DHgH@PHZHkfH5 1m#1AH=IA H <5 H- {IIff.AUA-IATH5 USHH HdH%(H$1H$Hl$HD$D$L$|mHH nmH|$H$H$H H H$H54mHE H$H H$H H$H5q H$H H$H$ H * H$0H$PDH$hLƄ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$(nDŽ$8H$@DŽ$HƄ$ptH$xHZlH$H DŽ$DŽ$H$)Ll$AąT$AEu'A}H,AąT$AE kZI}fHt$PHDŽ$)D$`)D$pD$`8T$lD$p)D$PAą9MtAEtTt7L/H$dH+%(HD[]A\A]I}I}.@A}/DAEH|$HD$HD$D$$1D$ 8L$(T$,D$0D$4fD$5D$7HD$8HD$@YAąL$HH5 1DA8S~HH5 1X[81LHH5 1&fH=A 1H 0 H "HHff.AWAVAUATUSHH $HdH%(H$1H AIHD$1H H$6IH$HH5)iMHH$(H  H H$H5O Ho H$H hL$H$XHT$H$8H5̼H$HH  H$H H$Ha H$pH5yH$H Y' H$HT$H$H$H$DH$HJ D$Ƅ$vDŽ$ Ƅ$0oDŽ$@DŽ$PƄ$xnDŽ$DŽ$Ƅ$cDŽ$DŽ$H$LH$HgH$LH$ H Ƅ$tDŽ$DŽ$(H$0$L,$AąOD$=L$H|$LT Aą28H|$Hctr1AMt+AEuI}[I}LHH$dH+%(HĨD[]A\A]A^A_fDHl$1ALH}HHEHDžHH)HH]T$AEtyI}fHt$PHD$p)D$`)D$PD$`(Hl$XT$lJAąH= H HDаI}fH$HDŽ$)$)$DŽ$(H$$DŽ$AągL$IH5K 1 =H 9ZH=P$ 3fD1@A}fAEH$HDŽ$H$DŽ$($DŽ$$DŽ$AEH|$ HD$ Hl$(D$0(D$4D$8T$ H$H=" H$XH$H$ H56 H$hH= H$H ! H$H$H$HH$H5 H$H$H$H$H=! H$Ƅ$aDŽ$DŽ$Ƅ$iDŽ$DŽ$Ƅ$@eDŽ$PDŽ$`Ƅ$bDŽ$DŽ$Ƅ$yDŽ$H$ H$H$H @ H$0H$H$H5' H$H 8! H$xH H$@H= H$XH53! H$H$H$H$H$H$H=$! H$H H$H5 H$H$H$hH$H H$H=@! H$0H5DŽ$Ƅ$lDŽ$(DŽ$8Ƅ$`nDŽ$pDŽ$Ƅ$SDŽ$DŽ$Ƅ$CDŽ$DŽ$Ƅ$8zH$PHW H$`H$H$H$H$H H$H$H$xH H$H= H$(HmH$H5= H$H H$8H=v H$`H$ H$H$H$H$PDH$pLH$H H$H|$8Ƅ$rDŽ$DŽ$Ƅ$ODŽ$DŽ$Ƅ$uDŽ$ DŽ$0Ƅ$XpDŽ$hDŽ$xƄ$tH$H[H$H DŽ$DŽ$H$Ll$8Aą$L$M15HHD$Ht$H|$HE1E11A@LLMIHHH$( dH+%(H8 D[]A\A]A^A_MLHL!L9H|$@HHHD$OHl$@1H}HHEHHDžHH)HLsAą*H H= DE1E11AF`Ht$H|$PIE1AL1fL^AEuI}I}{L3fDLt$H1I~LIIdžHH)HAMAED$tH|$`HHD$`Lt$hD$p0HD$xHDŽ$DŽ$Ƅ$sAą H H= DME11E1E111E1E111AkL$}1HPH9HHcL9ufuш$DD$,E1$AH$IH5 L Aą"$DL$,H5 LLD$H$Aą$t HH#$H $>Ht$H|$X=H\$X1H{HHHǃHH)HH$Ht$H$ HH$HC$C$fC$C\$CdH$H$$H$H$fD f9$`%tHHt$HHAE$ /VI}fHD$4H$p)$)$H$pHDŽ$xDŽ$8$H$:Aą/irDü85谿HH5 1 DA}fL|$P1ILIILJHH)HAU<AE$H$HHDŽ$L$DŽ$0H$HDŽ$DŽ$Ƅ$i$At A8OHHLLH H@(IQHLCHPHFЉT$,ofD$H=;L1Hr uH 5H= E1E11ADD$,AD8aHH5 1fADHD$ L$4H5 H11|@S띐KAk8XHH5 12-AEHt$4H$0HDŽ$8H$0$D1DŽ$@8$HHDŽ$L$Tf$UƄ$WHDŽ$XH$`QZLH5 1E1E111AwH=`AM H 3 HD #H5 15H5 1 1AH50 1A] H= 1III%III IIIIIIIkIWIIGI=IhIcIWIKIfh+xhwH[ HcH>1DwH HcH>@G GGGGGGGGGGGGGGGGGGG G G G G GGGGfAUA$H ATUH- SHHdH%(H$81H|$H\$HH jOH- DHL$0H HT$@H HL$XH 4OHD$ HT$hH; HL$xH ' H$HOH$H( H$HH$H/ Hl$D$vD$( D$`oD$pDŽ$Ƅ$tDŽ$DŽ$H$z2 AE1t0L8H$8dH+%(HHD[]A\A]Ë5RNH=SFC11҉5賸H=NHt$ R  Dd$ AH|$Hu,@H{HHHHtH3u{8t ADd$ 5H=ù^IHtv11H誻Aąx3|$ HHHL苴8Y|HH5 1V[8HÁ-IHH5& 1#D#AxH5 1E1AIHhH_HhHWHU1E0 DAUA$HATH5 L- USH< HdH%(H$x1H|$PHD$HH LH|$H$H HKHL$pH 8 HD$`H$H H$H5 H$H$HC H\$PH$IH % H$DH$H Ll$PD$XvD$h Ƅ$oDŽ$DŽ$Ƅ$tDŽ$DŽ$H$Aątc1Ll$MtAEbLڿHҿH$xdH+%(-HĈD[]A\A]f.H=JHt$ AątH|$PHu,H{HHHHtLu{8tL$ H|$HcULl$Hl$1H}HHEHDžHH)HAU+AED$4H|$ HHD$ Hl$(D$00HD$8HD$@D$HD$L{Aą~NwfI}I}f1AWA}`f苰8m|HH5F 1VH5, 1=|$ HHHH߻H=A H  H 艼HoHeHxff.AUAH$ATH5^HUHdH%(H$x1H|$PLD$PHD$HH H Ht$pH5V HD$PH|$H H$H D H$H5GHD$`H$H H$H5 H$HGH$H #" H$DH$H D$XvD$h Ƅ$oDŽ$DŽ$Ƅ$tDŽ$DŽ$H$Aąt\1Ll$MtAE\#LۻHӻH$xdH+%(HĀD]A\A]@H=FHt$ Aą<H|$Hc蕲Ll$Hl$1H}HHEHDžHH)HAU/AED$4H|$ HHD$ Hl$(D$00HD$8HD$@D$HD$L軭Aą~NfI}WI}f1AA}fˬ8q輯HH5 1OH5l 1}4|$ WHHH H@H="A!H  H TŸIIIAU1AHATH5DUHdH%(H$1H|$PfL$ -HD$LD$PHH Ht$pH5A H$H H$H5 H$(HL$ H$H5 H$HH HD$`H$XDH$pH d Hl$PD$XvD$h Ƅ$oDŽ$DŽ$Ƅ$bƄ$0HƄ$xtH$H ?H$H> DŽ$DŽ$H$[Aąt\1Ll$MtAE|SL{HsH$dH+%(eHD]A\A]@H=a>Ht$ Aą|$ tD$ |$ JL$ HH|$HcLl$t 1ACHl$1H}HHEHDžHH)HAUzAED$4H|$ HHD$ Hl$(D$00HD$8HD$@D$HD$L3Aą~F/f.I}ǫI}^fA}WfK88HH5 1+DH|$PHufI}HIHHHuA}8vv|$ HHHH@H5l 1}K>H=OAH  H3 聶[IbIXrIkDAV1AHAUH5 L-B ATUSH;HdH%(H$1H|$PfL$6HD$D$HH\$pH|$H H$H n H5 H$HG;H H$H5I H$Hb H$HL$H$H5 H$HL$H$H HD$`H$Ll$PD$XvD$h Ƅ$oDŽ$DŽ$Ƅ$iDŽ$DŽ$H$(DH$8H$HH R H$pH\$PH$H]:IH$XH  H$H Ƅ$0UDŽ$@DŽ$PƄ$xtDŽ$DŽ$H$wAątpLl$1E1MtAEL蔮H茮L脮H$dH+%(HD[]A\A]A^f.H=i9HAąH|$PHu-f.H{HHHHtL苰u{8t $8H|$LcLLl$6Hl$1H}HHEHHDžHH)HL"tE?ERH|$L蔤Lt$1I~LIIdžHH)HAU\$Dd$%AED$4H|$ H HD$81HD$ Lt$(D$00HD$@fD$HfDd$J\$L豟Aą~\DI}OI}1E1AA}״fE1ALl$DH= |f.H5l 1}x<$\$SHtH HtAH1LH=&A!H  H XɪHgH釽H鋽}H?AVA6HAUH5 L- ATUSH6H dH%(H$1H|$`Hl$(HD$D$(D$,HH$H|$H ~ H H$H56H$H & H H$HH$H5 H$H H$H HD$pH$H$ H5 Ll$`D$hvD$x Ƅ$oDŽ$DŽ$Ƅ$nDŽ$H$DŽ$H$8HL$,H$HH$hH\$`H$H45IH$XH  H$DH$HL Ƅ$@UDŽ$PDŽ$`Ƅ$tDŽ$DŽ$H$CAątlLl$1E1MtAEAL`HXLPH$dH+%(:H D[]A\A]A^fDH=94Ht$ oAąDH|$`Hu,H{HHHHtL[u{8tL$ t$(HD$u VxH Aą/گH|$LcL襟Ll$XHl$1H}HHEHHDžHH)HLt$(ŒAąH|$ L8Lt$ 1I~LIIdžHH)HAU\$,Dd$(AED$DH|$0HHD$0Lt$8D$@0HD$HD$PDd$TD$X\$\WAątpSLl$fI}I}~fA}wf1E1AE1AD|$ Dl$("HtH HzE11HDLeH5 1Ll$E1 @H=K |H= |H=A 1H Q Hj 踫|H=WA H " H; 艫<HٷHϷH÷H鵷H鮷H靷ķH鈷H|AUA1?ATHH5 UH- SH0HXdH%(H$H1f|$H|$PLl$HD$D$HH\$pH|$H, H$H H 0H$H50H H$H H$H5 H$Hc H$HL$HD$`H$H$H5E H$(H Hl$PD$XvD$h Ƅ$oDŽ$DŽ$Ƅ$nDŽ$L$DŽ$Ƅ$0bH$HH h H$XHL$H$H , H$H\$PH$H /IH$pDH$H [ H$H$ Ƅ$xHƄ$tDŽ$DŽ$H$1AątZ1Ll$MtAEyLQHIH$HdH+%(HXD[]A\A]ÐH=9.Ht$oAą|$tD$|$L$t$HD$u$OxL#D$AąH|$Hc轙Ll$Hl$1H}HHEHDžHH)HAU\$AED$4H|$ HHD$ Hl$(D$00HD$8D$@\$DD$HD$LܔAą~OkI}wI}pf1A@A}If8ؖHH5 1DH|$PHutfH{HHHHZH跣u{8??@|$Dl$BHHHDHt@H5 1VH=' vEӞ&H=חAH Z H  7H=A1H ) H إIH]HQHEH9UH$HAVA6HAUH5A ATUH-l SH*H@dH%(H$81H$Ll$HD$D$D$HH H|$H$H$Hڽ H z*H$H5 H6 H$He~H$H H$H5 H$H H$@HL$H$H$ H$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$nDŽ$(L$0DŽ$8H$XDH$xH H$H$H$H)IH$H  H$H Ƅ$`bƄ$tDŽ$DŽ$H$AE1t]LHl$HtEHǝH$8dH+%(H@D[]A\A]A^DH=(Ht$AąL|$tD$H$Hu*fDH{HHHHtHßu{8tL$L$HD$u JxLrAąBH|$HcHT$Lt$1I~LIIdžHH)HL$HzfHt$P1)D$pL$t)D$`)D$PD$`0Lt$XD$lhAą~S4JH}ϕH}fRE1Af}X4ADC80HH5 1 D|$l$HHHLfDBH|$ HD$ Lt$(D$4HD$00HD$8D$@L$DD$HD$L@H5L 1]E1 D[8'LHH5 1&H=AX1H H ,蝙H۬HϬHƬH鷬H髬H韬H铬fAVAQHAUH5 L- ATUSH<%HdH%(H$1H$Lt$HD$HD$HH$H߹ H H$H HL$H$H$H|$H$H5 H$HxH$H5= H$H- H$H$ H$@H5 H$XH! L$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$nDŽ$(L$0DŽ$8H$xH H$HL$H$HL$H$H  H$H50 H$H, H$HL$H$H5 H$0H$H$PH p IH$HZ#H$`DH$xH  H$Hu Ƅ$VƄ$bƄ$8HƄ$tDŽ$DŽ$H$rA1tYH豗Hl$HtE 3H苗H$dH+%(tHD[]A\A]A^ÐH=y"Ht$AąL|$tD$|$tL$|$L$L$HD$u xLWAąl'H|$HcLD$Hl$1H}HHEHDžHH)H|$t$uYHLAą=VH}H}莚f1AzAMIxf1)D$pt$tHt$P)D$`)D$PD$`0Hl$XD$lAą]|$Dl$HHH11DH}؝H$HuUfDH{HHHH>Lϗu{8##@Af{8hHH5R 1BDDH5 1%1%fDA@H|$ HD$ Hl$(D$4HD$00HD$8D$@t$DD$HD$Lhˆ89載HH5 11c&fDSH=ZA1H H< 芙I[IOICI7I-IIAU1AHATH5UH-! H@dH%(H$81H$fL$ 6D$L$HD$MHH H|$H$H$H 6H5% H$H H H$H5c H$HL$ H$H5 H$0H p H$H5 H$XHL$H$H$ H$@H5D H$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$cDŽ$(DŽ$8Ƅ$`HH$xH F H$H3H$DH$H e H$HN Ƅ$tDŽ$DŽ$H$cAąt\1Ll$MtAEtKL胑H{H$8dH+%(H@D]A\A]@H=iHt$AąD|$aL$_H|$Hc-Ll$t1ARHl$1H}HHEHDžHH)HAET$ +I}fHt$P)D$pfT$x1)D$`)D$PD$`0Hl$XD$lpAą1~S<I}׉I}nfA}gfAf.K88HH5 1#DH$HufDI}HIHH{HuA}8__AEH|$ HD$ Hl$(D$4HHD$81D$00HD$@fT$HfD$JD$LAą|$KHhH@HXHNH5 1,IBI8RIK@AU1AHATH5USHHHdH%(H$81H$fL$6D$L$HD$HH$H/ H H$Hn HL$H$Hh H|$H$H H$H5 H$H H$H H$H5 H$0HL$H$H$ H$@H H$XDƄ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$cDŽ$(DŽ$8Ƅ$`eH$hH$xH * H$HH$H D H$H= DŽ$pDŽ$H$Ƅ$tDŽ$DŽ$H$4Aąt]Ll$1MtAEuLLTHLH$8dH+%(HHD[]A\A]@H=9Ht$oAąT$23H|$HcLl$t1AUHl$1H}HHEHDžHH)HAET$3I}fHt$P)D$pfT$x1)D$`)D$PD$`0Hl$XD$lHAą~[Ll$f.I}规I}>fA}7fAf.}8HH5 1yD|$\$Dm趮HYH`HIA9݉HAF6f.AEH|$ HD$ Hl$(D$4HHD$81D$00HD$@fT$HfD$JD$L|f.H5 1[H5 11A衈HPHFdHPHQAUAHATH5nUHdH%(H$1H|$PfL$-HD$LD$PHHt$pH5 H q H$H5T H|$H$Hu H5H$H HD$PH H$H5 H$HL$HD$`H$H5 H$H$H H$8HH$H H$(DD$XvD$h Ƅ$oDŽ$DŽ$Ƅ$cDŽ$DŽ$Ƅ$0tDŽ$@H$HHH DŽ$PH$XpLl$A1tRMtAEAL萇H與H$dH+%(HD]A\A]Ð蛎H|$Hci~tALl$Hl$1H}HHEHDžHH)HAUDd$LAED$4Ll$ HHD$8L1HD$ Hl$(D$00HD$@fDd$HfD$JD$LuyAątv~PtAątY\Ll$MtAEtrtULM{H$dH+%(HĘDA\A]T$ H5m 1lI}tI}.@A}/D#m8)pHH5 1=fxH=qA>1H H cyI鴍H3H5 H1lxlHff.fAUA-HATH5a L- USHHdH%(H$1H|$ D$ HD$HH ř H\$@H HL$PH H|$Ht$hH5 Hq H$HL$ H\$xHV H$H5 H$H  HD$0H$H\$ H$IH$H L H$DLl$ D$(vD$8 D$poDŽ$DŽ$Ƅ$eDŽ$DŽ$Ƅ$tH$HH$H DŽ$DŽ$ H$(-Aąt^1Ll$MtAE>LMxHExH$dH+%(HĘD[]A\A]DH=1Ht$ gAą$H|$ Hu$H{HHHHtL[zu{8tL$ H|$HcnLl$u|Hl$1H}HHEHHDžHH)HLbAą~PI@I}pI}~{f1AA}gf[i8}HlHH5 1"iDH5 1J|$ M\$ ۚH.HpHL1H t~quHHH҉@UH5HAWIAVAUATSH8dH%(HE1uG}H}LcLmtOHEE1AfDH}uLuHEdH+%(HeD[A\A]A^A_]fLu1ۺLHI~LLuHIIdžH)HH}vlnLmHLI}LIEIDžHH)HL^Aą4HEH= <k|$Pt \H= !^@Akd1DH5# ADA1K,fDXNfD#L8OHT$@H5k H1@D$ E1HD$`H= HD$/\$iH|$8HD$`HHD$ CŅu!$PD$H}K8jNHHD$`H5 HD$1:l$;K8؉D$,NHT$@H5 H1H O,H=4 `D$HD$`DHD$H5G 1記D$K L$HHD$`HD$UV+W3lHKlHKlf.AU1AHATH56/ USHHHdH%(H$81H|$@fL$ ?HD$LD$@D$ HH\$`HL$ Hw H\$pHu Hv H$Hu H=w H$HxH$H HD$@H/| H$H H$H5DH$HL$ HD$PH$H$H H$H5 D$HvD$X Ƅ$oDŽ$DŽ$Ƅ$sDŽ$DŽ$Ƅ$ aH$8HL$ H$(H$pH$H R H$HH$`DH$H i H$H|$H$H DŽ$0DŽ$@H$HƄ$hbDŽ$xDŽ$Ƅ$tDŽ$DŽ$H$nAąCL$  D$ P<T$ Hl$fHt$ D$(HD$8Ht$ 5D$4L$8ED$( t$0T$9H}Ht$ IAą y8.% t L$ T$ H5 1FD$ <DHc f%ft#H/ ftf H- H HDH5 1aFHl$HtEHJTH$8dH+%(HHD[]A\A]fEH|$ D$,JAąOF8l Ht$0H5j HD$H|$Hp HL$@H xj Ht$XH5HD$ HL$hH | Ht$xH5l H$HH$H  H$DH$H D$vD$( D$`oD$pDŽ$Ƅ$tDŽ$DŽ$H$Ld$AŅu"A$A|$CLd$AŅxpMtA$tSt.LKH$8dH+%(HHDA\A]I|$vDI|$ Of.A|$S@<8)?HH5 1ƊLd$\@HH=AA.1H ۠ H|v O;II^ff.@ATHH5 AUfHdH%(H$1H|$XHt$PH5} )D$L$HD$HHt$hcH5e H$H5f H$HHL$D$`H#h H$H5N H=H$H5ti H$HAn H$H=g H$H5g H$H$(H=:D$XD$pD$xDŽ$Ƅ$DŽ$Ƅ$DŽ$Ƅ$Ƅ$vDŽ$ Ƅ$0oH$8H5x H$HL$H$H H$HL$H$ HL$H$hH H$HH=@ H$XH5< H$xHL$H$pH=> H$H5\ H$HL$PH$H= H$H5' H$H $ H$0H= H$HH5\ H$HL$H$H$H= H$H$H5 DŽ$@DŽ$PƄ$xdƄ$iƄ$nDŽ$DŽ$(Ƅ$PuƄ$aDŽ$DŽ$Ƅ$pH$HL$H$H$H=g H$@H  H$xHH$ DH$PH  H$hH|$H$H{ DŽ$DŽ$Ƅ$(eƄ$ptDŽ$DŽ$H$AąL$AʃD$t&% D$T$HD$@f)D$0D$8D$T$=D$<D$)D$ D$>D$D$((D$?D$L$4D$@HD$OHxHt$ HAąHl$HtEHJEH$dH+%(RHD]A\DT$D$f@H|$ D$,EAąn/78e :HH5 1EDH}G>H}HGf}L1il@BH5 1薄fDADAQH5 1bH5 1MH5 18H5 1#BHXATUHSHH dH%(HD$1|$ HH$D$D$D$*:Aąt+{!uExJ8uC%ǃu9HEE1DHD$dH+%(ubH D[]A\@; t˅/z580k8HH5 1Ej AHAAUAH6ATH5fUHdH%(H$1H|$@Hl$D$0)D$LD$@HD$D$D$1)D$ HHt$`H ` H5pb Ht$pH5` H` H$H XH=b H$H5Zr H$H ;jHD$@Hf H$H5h H$HL$HD$PH$D$HvD$X Ƅ$oDŽ$DŽ$Ƅ$ODŽ$H$DŽ$H$H5a H$8H  H$pHH$H|$H$HH  H$`DH$Hu Ƅ$ HƄ$htDŽ$xDŽ$H$觉Aąu/|$HD$xHHAątQHl$HtEtgH@H$dH+%(HD]A\A]|$L,$l$dHtHxHtL@H}9H}nD@}pHtH=D7A1H E H&l tEH5 1A >HTff.AUAATSHH0dH%(HD$(1|$HH$HD$D$ D$t$?Aąx[t)BgHD$(dH+%(u|H0D[A\A]DDzIDHH5 10f.K18!<4HH5 1@ H$H=2 H$H P H$xHT$(H$hH$H$H$H5 H$0H=G H$@H$`H 6 DŽ$8Ƅ$`lDŽ$pDŽ$Ƅ$sDŽ$DŽ$Ƅ$iDŽ$DŽ$Ƅ$8pDŽ$HDŽ$XƄ$mH$H$HT$)H$HfV H$HT$*H$H5 H$(HT$0H$H= _ H$H @\ H$8H5qW H$pHז H$HOH$PH$`LH$LH$HH$HYk DŽ$DŽ$Ƅ$rƄ$XbDŽ$hDŽ$xƄ$tDŽ$DŽ$H$蒥 AątkE11Lt$MtAXLP6LH6H@6H$(dH+%(H8D[]A\A]A^A_@52H=3-FC11҉5`-+L$*H|$HډV{Aą(8Hc,H<-H=A1H w HM 3' 8HH5\ H1aAI6I66Iy6Im6I6IU6II6I=6I16I%6ff.@ATUSHHLdH%(H$1@H1HH  AGHŅ'DE1AHc1IH(H$dH+%(HL[]A\fH1HH g AH1RŅhE1=F~8HH5 H1__fDE1=BH H= ' aAWAH-AVH5nfAUATUH-= SHD? HdH%(H$1H|$`D$PHD$ )D$0)D$@HH "O Hl$`HC H$H5:= H=y? H$H2= H$H5ʩH$H3 H$H5> H$HL$4HD$pH$H|$ H$H 6 H$ H\$`H$8IDD$hvD$x Ƅ$oDŽ$DŽ$Ƅ$HƄ$@tH$HH%H$XHZR DŽ$PDŽ$`H$hwfAątXHl$ HtEHH$dH+%(HD[]A\A]A^A_fDH=Ht$fAŅ|$4L$H\$ 1HMHHt}|$\$QGAHtH@ Ht H\$Qt8H+H}H}!/}%!#HHcD$QD{#LcLHHLHi11à Ll$(Lt$0HHуL$ u@tq؃ v׾`LLDD$06HcT$0HL$(HHtZ((wHHrB 1؃ p؃<à K@tofDH ؃ Xt$ %DH|$`Hu%H{HHHHHu{8@H5L: 1][EUDHD$ Dd$ :H=#A61H Tq HG S A3 8HH5{ H1ZڅkAH/ff.AWA IAVH5l: H8 AUL5& L-C{ ATUSH\HdH%(H$1H|$0L$HD$(MHH$D$0HH$HL$8Hr8 H$H<8 H5ܤH$HI H|$(H$H> H$HAH$H5 H$HT$0H$H$0H$@H?> Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$H$ Ƅ$(ODŽ$8DŽ$HH$PH5I H$H y H$HL$4H$HL$@H$H y H$(HL$DH$H5 H$`H y H$H5y H$pHL$HH$@H5_ H$H y H$H5M H$HL$LH$xH$H$PH$H$H5xy H$L$hƄ$pVDŽ$DŽ$Ƅ$mL$DŽ$DŽ$ DŽ$XDŽ$hDŽ$DŽ$DŽ$H$H x H$HL$PH$8H x H$HHL$TH$H x H$HL$XH$H5x H$H x H$`H5x H$HL$`H$H5x H$H x H$H5x H$ HL$hH$8H5x H$XH x H$(H$pH$H$H$HH$hHL$pDŽ$DŽ$0DŽ$@DŽ$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$PDŽ$`H$H5x H$H$HT$xH$Hw H$Hw H$H$H$0Hw H$@Hw H$XH$H$xHw H$Hw H$H$H$Hw H$Hw H$H w H$H$H$H H$DH$ H$hH$H$DŽ$DŽ$DŽ$DŽ$DŽ$(DŽ$8DŽ$pDŽ$DŽ$DŽ$DŽ$H$Hv H$HV4 H$@HCH$0LH$PHmH DŽ$Ƅ$8tDŽ$HDŽ$XH$`L|$r\D$Ld$(tUMtA$dLH$dH+%( D$H[]A\A]A^A_fDLsH$HD$HHu)fIHIHHHuA8A$:E|$H\$HDH{HHHHWLOu{8ADt$0AP&A ~PAFDwGHg HcH>fDAHT$HHADHL$8Ht$DDDD$4t1D$H|$toH|$Hc2 Ld$(cA$ Al$H$IHtLd$HDI|$HIHHtKLJuA|$8t7L$@Ht$ DD$4[H$IHKLd$LDI|$HIHHH5r uA|$8L$DHt$DD$4oH$HHHT$@HBHHHH8cuxcuxuހz8L$HHt$DD$4yH$HHiLd$fDI|$HIHHHH5 uA|$8,L$LHt$DD$4H$HHLd$@I|$HIHHH5q uA|$8L$PHt$ DD$4H$HHLd$@I|$HIHHxH55q uA|$8\L$THt$$DD$4'H$HHLd$@I|$HIHHH5p uA|$8DD$4HL$X(Ht$>H$HHLd$I|$HIHHH5p :uA|$8DD$4HL$`0Ht$FH$HH6Ld$I|$HIHH@H5|$LfDqfDH}wH}f}pH5] 1>ADCD$<HT$(lD$DHT$0D$8D$@QIHI1f9\$PtH8 wmHHr#uoÃh~D$ D$&H|$0\$DrAƅ8tPEHD$(t.HcADC؃(wIr`fIEx%ǃuHD$(H@LHcPDL9AfH$Hu3fDH{HHHHLou{8@H5 1=Dd$ Z8+HH5[ 1<LEH=AI1H R H( A58xH5] H1R<AHf.U1H5x SHHտ1H5 1H5 S1H5 {HS 1H5 dHS(1H5 MHS01H5 6HS81H5 HS@1H5 HH5 1HH5 1HH[H5 1]@AUH1ATIUSHH5 HH/1H5ʼn HmH9HGHt4L-c DAL\L19HHH9uH[]A\A]fAUH1ATIH5 UHSHHU1H54 Mt4L- fDL]L1HHI9uH[]A\A]ff.AWH53 1AVAUATUSHH(H|$cH5* 1NDs1H5, DDt$/S1H5F S1H5_ ED$AL5 L-' DIcHl$H5I 1U]1H5Q U1H5 AGD$Aǃt{tR1DMcLd$LI $1AOAL$L169u‹D$D<D$D$;D$:H([]A\A]A^A_L$1H5 fSHHH5 1H1H5Z SH  twZH H HEH5 1sS 1H5Ɉ \S H5 [1EDH H HEfAWHH5 L=Ɉ AVE1AUATIUH- SH1V HD$1H= fIIt>G,DAtDL1D$u, IIuH[]A\A]A^A_fDH52 1MAHH5! HEտ1/AHH5 HEտ1AHH5 HEտ1AHH5 HEտ1AHH5 HEտ1DHڿAH5 HEՉD$ 1Dl$ HH5 AHE1fAHH5 HEտ1HAHH5 HEտ1*AHH5| HEտ1 A HH5o HEտ1]fAWHH5 L= AVE1AUATIUH-@ SHS HD$1H= fIIt>G,DAtDL1TD$u, IIuH[]A\A]A^A_fDH5 1 AHH5 HEտ1AHH5 HEտ1AHH5 HEտ1AHH5 HEտ1DHڿAH5 HEՉD$ 1jDl$ HH5z AHE1GAHH5m HEտ1)AHH5a HEտ1 AHH5] HEտ1A HH5P HEտ1~f.SHHH5 11H5# S1H5 pSH5! [1VfDAW1H5 AVAUIATUSH<AUH5 1AEH <tH <tHjH HDH5 1AUH5 1AU1H5 AUH5G 1{AU H5 1cAU 1H5 K5AU H5 1+AU H5 1AU H5? 1AUH5 1AUH57 1AU1H5k AUH5o 1AUH5r 1AUH5r 1lAUH5 1TAU H5 1D@}vHSf.H% @HcH>H HH6 H H H H HH H H H H H H H H) H H HH H H H H H H H H H H H H H H H% H7 H< HD HS HV H\ He Hf Hy ff.ATA*L@ ~F>H{ HcH>L% tL& H LEL%JH  dL1LA\fL L L L1t L L s@L c@L S@L C@L 3@L #@L @Ls @Ls @AUAATUSHH-cdH%(HD$1Ld$LH8!|$#jHgLH !u|$uiHgHHHt!HT$dH+%(uGHD[]A\A]fHD$dH+%(u&H[]A\A]D>gHdv%D@wHo @HcH>HOH H Hs Ha HN H7 H H H H His H1s Hr HD Hr Hw HZ H6 Hr Har H H1r H H8 Hs H Hv HS H% H1 AUH5 ATUH SHdH%(HD$11D$fD$1 HQHHE1H_HIHtHIHIGHH5$ LLd$fD$@I9H3HLuHLAHgfffffffHH?HHH)Hj H=`HLuh<$ubEL IH H LDL%l1dLhHD$dH+%(uHHL[]A\A]f.EL  IH*LH O LDE1UKff.wH HcH>HLH H Hi HQ H7 H H H Hq H H H Hyq Hr H Hf H9q Hq H: Hp Hp H H H Hap H H H)p Hv H] H@ H@HX H H H AW1IAVAAUATUSH5r HH-bH<$T$HHL$ 1ӿH5 r A AAH5 1ADt$8WAW1H5 @IW1H5 )AWH5V 1AWH5 1IW1H5 IGHD$IG$Ht$HHD$H H \ H5 H1IW,1H5 AW4H5 1qAW6H5 q 1YIO81H5 =IOL(1H5 !IOt1H5p AtH5} 1Av1H5p E| H=x 1L- H$LE<$EtN1 ft@DtD HtAsDLH1SufDIu H= 3H$PBt$Ht$-L9 E1L=_ @DH5 1A>9H5 H1AVH5 1{AVH5 1cAVH5p 1KD$8AVH5 1'IV1H5} AVH5 1AVH5p 1AV1LAFA>D$AH0 HcH>fAVH5 1҃}H t!H l tH ] H|l HEH5o 1:H=i 9f Anl$AH$D9hv-AIFH;D$sL4$AFAV;D$ HH[]A\A]A^A_Ë\$H=Pr H$1H5 虿S1H5 肿]|$H<$K FDd$H= L$$aAl$ED$H5q A$DD$(H1A$IDHt$(H‰菉\$H=q H$1H5Q S1H5Q 詾S1H5 蒾m\$H= H$H5 1dS1H5 NS1H5 8\$H=p H$/H5 1 S1H5p S1H5 ܽS1H5 ŽS1H5 诽\$H=, H$H58 1聽S1H54 jS1H59 T/\$H=A H$KH5n 1&HS1H5/ HS1H5- S 1H5/ S!1H5Gn ʼS"1H5`n 購S$1H5 蝼S(1H5w 膼S,1H5 pKD$H $DfA HH JcH>AFAVH=C L%)ЃHHi98H#HD$(H$l$.H4(1f.J߀^CAHHuvH1LH5 赻H= #H$Dl$0L% H\(1Al$(fH5 1AH$bSL1OS߿1H5 8S1H5 "HS1H5 HS1H5 D9kDl$0\$H=k H$H1H5 跺HS1H5k 蠺{H=S \$L%)H$1.fJ߀^CAHHuHLH5$j 151.fDTJ߀^CAHHuHSL1H5j S1H5 ԹS1H5 轹S1H5i 覹S1H5j 菹S1H5%j xSH= wHT$ |$H<$y+H$vAAAEH A̿H H5:g HD1H t H tH Hp HEH5)g 1赸տ1H5Lg 蟸H= iHHH=^g []A\A]A^A_H5 1\4l$(AD$ l$(H Lt$0H HE1Dl$IH@H` <tH0` <t H_ IEHH1AɷD9t$(t,AEHu <tvH H=ÁHt=*HG HcH>fHj Hj Hj Hj HAk Hj HYk HB Ht HI HJ Hi Hi Hi HQi H!i H H H Hh Hh Hyh H_ HC H) H H Hn ff.@ATUH@tF wHHH5D GHH]1A\/HcHDžt^B؃(wHHrFD'DH H9 H~ HD HI Hо Hվ Hھ H߾ H ~vGuGHh @t4wcHth @t%@H" H3 HDHh Ã|w Hξ @H @HcH>@H]h Hݾ HDfH Hh H HǾ Hh H H¾ HIh Hh H& H Hپ H H Hg H AUIATUSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1Hl$ H=\JH|$ QL% OH$H=!JHD$HD$HD$0D$0HD$ :u|$ u-QL%NI$8Ht HT$LHD$(dH+%(u*H[]A\A]fD~NL%LZeDUA~HH5 HAWAVHLAUATSHPIHxdH%(HE1H ƅ|H1HHH H HH@ HpHHHH=af HH H(H5 H8H HHHH5J H`HuYHpHDžhHDžpDžxDž~ƅvDž ƅ oDž0Dž@ƅhnDžxHHtHH5 HHxHH HH5] HHyHH˻ H H5e HXHzH8H HhH5 HH|HHHHHH HHH=~ HH5v DžƅlDžDžƅDDžDžƅ@TDžPDž`ƅSDžDžƅOHH~HH=Wd H0HHH H@H5 HxHHH= HH HXHd HH5 HHHH= H@H FHHc HDHH c H0HhHPH DžDžƅeDž(Dž8ƅ`HƅbƅiDžDžHƅ8tDžHDžXH`Aąx<H5 1 E1ALϹHhHHt)fuH{HH{߽H藹HEdH+%(_HeD[A\A]A^A_]f|t1E1E1XHdLHHhDž8@4DHp|xtzfpAąe/dH|H5b xDpPDz1TXZMt6LN6 f||y~E1E1t ЉÅ3 IHH?tH1κE1l8HH5a H1D#AfDE1YAD觿{f{蘿苩8Y|HH5ֶ 1V@tLJ.D8H5IILL9utD륐11'AƅtL輹H5(` 1H5H` 1H=A>1H H л2H5 uPAN k8dHH5 H17AHHHHHHff.ATAHQUH5@E1E1H(dH%(H$1H$Hl$fDD$ D$L$HD$HD$D$"fDT$$HH$H5 H H$H5Z H H$H5R H=f H$H5?H$H H$H5Փ H$H W H$H$ H5o H$0H$PH=^ Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$(nDŽ$8H$@DŽ$HH$hHL$H$H ³ H$HL$ H$HL$"H$H q H$xH5U^ H$H=Բ H$(HL$$H$H$H5IJ H$H=#\ H$H$PH$`H H$Hy>H$@DH$pH|$H$H ] H$H Ƅ$psDŽ$DŽ$Ƅ$cDŽ$DŽ$Ƅ$TDŽ$DŽ$ Ƅ$HSDŽ$XDŽ$hƄ$tDŽ$DŽ$H$$Aą|$T$"1H|$8 HHD$D$X`HD$0HD$@D$\>=H|$0fT$vD$`D$D$dD$ fD$tD$$fD$|AąHl$HtEH蝱H$dH+%(H(D]A\HD$0/xH趦Aą薣8胦HH5 1]UH=1\ <H}菪H}&<}(.8! HH5 1軮f諮SH=A1H H ߵT$"4H5" 1}AoH=[A1H H= 苵H+HIȀ?wHH9<t{<tWt3H5ȯ 11H5'[ H )HL9v1HD1tҹ0)ѺHL9vHÐ1PwH1H5Z eHff.AWAfAVHAUATUSH:H(dH%(H$1Ht$hHl$`HD$H$)D$`L$HDŽ$)D$p)$HH$ H H H$0H H=X H$HH H < H$XH]9H$hHf H$H H$xH@ H$H$H H$Ƅ$vDŽ$ Ƅ$PoDŽ$`DŽ$pƄ$nDŽ$H$H$Ht$pH$HJ H$@Ht$rH$HW H$Ht$sH$H H$H5X H$ HY H$Ht$tH$PH= H$hH H$H5@ H$H= H$H H$@Ht$uH$H$0H$xH$H=X H$(H DŽ$Ƅ$sDŽ$DŽ$Ƅ$(cDŽ$8DŽ$HƄ$pTDŽ$DŽ$Ƅ$dƄ$lƄ$HfH$`Ht$vH$H5_ H$Ht$xH$H5^ H$pH=G H$H$H$HW H$H=W H$8H$H$H H$HH=" H$H5 H$H$H$(H$pH$DH$H|$Ƅ$pDŽ$DŽ$Ƅ$rDŽ$DŽ$Ƅ$ mDŽ$0DŽ$@H$`Ƅ$haDŽ$xDŽ$Ƅ$SH$H$H$H @ H$H O H$H$H$H V H$ H H$8H$H$XH R H$HH$hH G H$H45H$H V H$HZ DŽ$DŽ$Ƅ$CƄ$@DDŽ$PDŽ$`Ƅ$tDŽ$DŽ$H$3AƅD$v<5D|$rDA |$ttf|$ut@|$st$tt$`HD$u xHdAƅ4H|$ LcLLd$t~1E1AMt-A$uI|$KI|$L虨H葨L艨H$dH+%(H(D[]A\A]A^A_DHl$ 1H}HHEHHDžHH)HLt$`襒AƅH|$(LAƅGLl$(1I}LIEIDžHH)HD$`A$D$AD$D$DH|$0HHD$HD$HD$0Ll$8D$@0D$PD$TD$XD$\*2D$1D$Ht$xH$D1HD$hf)$H$H$DŽ$`H$A$)$)$)$)$AD$$1AH$D $D$`f$$D$pf$$f$$f$$f$HD$xH$D$$D$$RAƅgu}H= Ld$$38e HH5k 1f.Ld$1E1Ld$E1ADq×8谚HH5 1Ld$E1rDA|$~f UЃ0 HAD ƒT$щƒL$DAAE ƃA@t$oD8AܙHH5h 1x苢fD{fDkH5 1vLd$1E1AVAH=?A-1H x H! oH=AO1H G H >H=ݚAE1H  H  ~HƹH麹H鮹H頹H锹H鈹H~HuHdHXHCAWAVAUATUSHH $HH-E1dH%(H$1L$AHLL$L$ fDD$pH5 D$PL$HD$D$rD$tHLHLHH H$HL$XHL$`HL$hlHH$H! H H$H` H z> H$HX H=O H$H,H$H H$H H$H5l H$H\$PH$H$ Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$nDŽ$(H$0DŽ$8H$@H5* H$XHt$XH$xH55N H$H5H$Ht$`H$H5JN H$hH$H$H5Ρ H$HL$hH$H5 H$HL$pH$H= H$0H5 H$PHL$qH$`H=HN H$xH5z H$HL$rH$H=EN H$H5mx Ƅ$`aDŽ$pDŽ$Ƅ$bDŽ$DŽ$Ƅ$sDŽ$DŽ$Ƅ$8dƄ$wƄ$rH$HL$tH$H= H$H$(H M H$`H*H$DH$8H M H$PH|$H$pH Ƅ$cDŽ$ DŽ$0Ƅ$XtDŽ$hDŽ$xH$A1tZHҞHl$HtEH謞H$dH+%(HD[]A\A]A^A_H|$XL H|$`L H|$hAL fD9ABf9CfD$f=|$Pu%HD$0=xHrAąL$tuD$pT$q T$r ЉD$tH|$Hct1AHl$1LLH}HHEHDžHH)HLHDD$譖HD$Hl$(HD$ D$0(7@D$4g(H|$ D$8D$PD$H}OH}>}0ۄ8!̇HH5 1{fkSH=oA1H x HQ 蟗D$)AH56 1:AnH=A1H ! H H蹐Hlff.fATAIZUH5H" fHXdH%(H$H1H|$pHl$HD$)D$LD$p)D$ HH֯ D$xvH b H$H51 H=Dp H$H5p H$H5o H$H5HD$pH͵ H$H5 H$HH H$H$HL$H$H= H$H$0H5 H$XDŽ$ Ƅ$oDŽ$DŽ$Ƅ$nDŽ$H$ DŽ$(Ƅ$PcDŽ$`H$HT$ H$Ho H$HT$(H$hH H$HT$)H$xH A H$H=. H$@H H$H5A H$H$H H$ H= H$0H$hHT$*H$HyH$PDH$LH$H A H$H|$DŽ$pƄ$kDŽ$DŽ$Ƅ$rDŽ$DŽ$Ƅ$(pDŽ$8DŽ$HƄ$piƄ$tDŽ$H$H DŽ$H$$AąDD$ED$)<T$(HL$D$H8HD$@HL$0HL$ HL$8HL$1IL$L +H|$0D$\D$*L$PL$T$XL$TD$`蘏Aą谵Hl$HtEH蚍H$HdH+%(HXD]A\DHD$8LxH趂Aą8胂HH5γ 1]XH=Ï ?H}菆H}&?}(18! HH5S 1車f諊SH5 1AH5 1H=yAS1H r H[ 詑T$(D$) H=>AA1H 7 H nߊH驢ATAHQUH5E1HdH%(H$1H|$`Hl$fDD$ HD$LD$`D$HD$D$"HH D$hvH H$H5W H=jj H$H5 H$H5 H$H5-H$H HD$`H H$H5w H$8HL$HD$pH$H= H$H$ H5S D$x Ƅ$oDŽ$DŽ$Ƅ$nDŽ$H$DŽ$Ƅ$@cH$XH O H$HL$ H$HL$!H$H H$HH= H$hH5Ռ H$HL$"H$H$H= H$H5 H$H$0H H$hHH$H|$H$@DH$XH y< H$xH DŽ$PDŽ$`Ƅ$tDŽ$DŽ$Ƅ$aDŽ$DŽ$Ƅ$iƄ$`tDŽ$pDŽ$H$Aą|$D$!<HT$D$@0HD$8HT$0HT$ RT$DH|$0|$"D$TT$HT$D$XT$LT$ T$PEAą=Hl$HtEH'H$dH+%(HD]A\fHD$02xHF}Aą&z8}HH5^ 1[H=A< 蔋BH}H}趋B}踏4y8!|HH5H 1vKf;SH=?~A1H ( H! oD$!DH5ˉ 1 ArH=}A1H ѫ Hʲ 艅Hjff.fAWH1AAVHAUATUHdH%(H$1H|$`ft$,H5SHl$$LD$`HD$HD$$HH %H$H5 H$H5R H H$H5J H= H$H5 H$H d HD$`H H$H5a H$H HD$pH$H$ H5 D$hvD$x Ƅ$oDŽ$DŽ$Ƅ$nDŽ$H$DŽ$H$8HL$(H$XHL$,H$H 9 H$HL$-H$HH$hH=n H$H5 H$H ڤ H$ HH$H|$H$DH$H d9 H$0Hո Ƅ$@dDŽ$PDŽ$`Ƅ$eƄ$bƄ$tDŽ$(DŽ$8H$@AątmLl$1E1MtAEJLكHуLɃH$dH+%(HİD]A\A]A^A_fDH=Ht$ Aąt|$-tD$ L$$HD$u xHxAąPD$(PwqD$(AAOH|$HczLl$td1E1A@I}w|I}fD$(AAf.A}fHl$1H}HHEHHDžHH)HLlE`tD$,IcFIHHD$8AEHD$0D$@(oAED$D& H|$0|$,Dd$PD$HD$$D$TD$L%|Aąt~L赩Ll$|$ Dl$,٥HtHPHt1EDLfDs8vHH5 1s8IāvHH59 1_E$$Ll$E1AH5$ 15;s8A,vHH5w 1~NfD~qfD~H=wA1H H dAH=wA1H _ Hh 超'D$EI+IIIIIIIҖIƖI麖fDAWAfAVHAUATUSH H8dH%(H$(1Ht$8Hl$0HD$H$)D$0L$)D$@)D$PHH$H$ H H$ Hc H= H$8H[ H ˣ H$HH H$XH H$H H$hH] H$H$H H$Ƅ$vDŽ$ Ƅ$@oDŽ$PDŽ$`Ƅ$nDŽ$H$DŽ$H$Ht$@H$H} H$0H5( H$H_( H$@Ht$BH$H} H$xH5 ~ H$H} H$Ht$CH$XHa3 H$Ht$DH$H=} H$H} H$H5} H$H$ H$H=x) H$H$Ht$HH$0H} Ƅ$sDŽ$DŽ$Ƅ$cDŽ$(DŽ$8Ƅ$`lƄ$fƄ$pDŽ$DŽ$Ƅ$8rH$@H$HL$PH$(H <} H$PH5| H$8H <} H$xHt$LH$PHL$XH$Ht$NH$pH J2 H$`H=| H$H$H| H$H$H5M( H$H  H$HH$H|$H$DH$H 2 DŽ$HDŽ$XƄ$aDŽ$DŽ$Ƅ$mDŽ$DŽ$H$Ƅ$SDŽ$ DŽ$0Ƅ$XCƄ$tDŽ$H$H~ DŽ$H$AƅkD$D< |$Btf|$Ct@|$Xtt$0HD$u xHoAƅǁH|$ LcLqLd$ty1E1AMt-A$EuI|$sI|$t~L,zH$zLzH$(dH+%(H8D[]A\A]A^A_Hl$ 1H}HHEHHDžHH)HLt$0=dAƅZH|$(LpAƅLl$(1I}LIEIDžHH)HA$D|$0rAD$D$tH|$`HHD$`Ll$hD$p0HD$xDŽ$D$DŽ$Ƅ$kD$1E1t$HH|$PDHD$8f)$H$HD$PDŽ$`H$A$)$)$)$)$AD$$nH$ f$$D$0D$$D$@f$D$L$D$HH$D$$tAƅcuyH=M{ {Ld$]j8elHH5; 1ʷf.Ld$1E1Ld$E1ADAi8lHH5j 1ZLd$E1DA|$NfٞUЃ0 HAD AǃAT$AƒEAAAE AǃAAf.h8AkHH5y 1膶|[tfDKtfD;tLd$1E1AA4H="mA1H ۚ H R{)H=lAH Hա #{dH=lA 1H { H zct陌H騌H鞌H钌H鉌HxHnH`HVHHH H$ HL$&H$0H$xHH$@H & H$PDH$hH|$Ƅ$PsDŽ$`DŽ$pƄ$mDŽ$DŽ$Ƅ$aDŽ$DŽ$Ƅ$(lDŽ$8DŽ$HƄ$ptDŽ$H$H DŽ$H$A1tXHlHl$HtE+HkH$dH+%(HD]A\A]H=Ht$AąD|$$`D$ D,LHHHD$Hl$@HD$8HD$0HD$D$H81@D$LYH|$0D$PD$D$TD$ D$XD$$D$\D$&fD$`lqAątu~CܒH}wdH}of}s\8q_HH5n 1ƪy|$觎HfHHVLHIH5l 1}1.fDKhH52$ 1V1AH=2aA 1H ێ H boAhIMICIVINATH1AUHHdH%(H$1H|$@ft$H5yHD$LD$@D$HD$HHt$`H5< H W Ht$pH5~ H H$H5v H=Lh H$HL$H$H5H$H m HD$@H H$H5" H$HL$HD$PH$H=" H$H$H5l D$HvD$X Ƅ$oDŽ$DŽ$Ƅ$ODŽ$DŽ$Ƅ$ iH$(H$8HL$H$H " H$HL$H$HH=>l H$`H5" H$pH$H$H H$HH$H|$H$DH$H " H$H DŽ$0DŽ$@Ƅ$hlDŽ$xDŽ$Ƅ$uDŽ$DŽ$Ƅ$tDŽ$DŽ$H$ 觯AąuuD$<HT$D$( HT$ HT$ RT$,H|$ D$>T$0HT$HT$4T$fT$H6YH$dH+%(5HD]A\ÐH= ]fH}RH}.]@}0afD#K8)NHH5] 1UfVH5] 1ƘA'H5P] 1襘H5s] 1荘H=tOA!1H | HV ]L$T$D$t$l@ֿ1H5 /dVHpfU1SHHQHtHH[HW1H[]H1H5 ŗff.U1NHHt,H=ENH1H\H7W1]1iQHHu1H5h N]AWAHH~ AVAUATUSHHXdH%(H$H1H$HD$ D$(HD$0D$8HH$HL$ Hv H$Ht DHu H$Ht H$HjH$(Hs H$8HH$H{ H$PH H$H$`H$pHL$(Ƅ$vDŽ$ Ƅ$oDŽ$ DŽ$0Ƅ$XsDŽ$hDŽ$xH$HZ H$Hd H$H(r H$H~ H$HT$0H$HZ H$H$HT$8H$(Hf H$8H$H;H$H$H$HH H$XHu H$HB Ƅ$lDŽ$DŽ$Ƅ$nDŽ$DŽ$Ƅ$0mDŽ$@DŽ$PH$pƄ$xtDŽ$DŽ$H$UD$tE1E1H0TL(TH$HdH+%(5D$HX[]A\A]A^A_5H=KFC11҉5HK{IDD$8AT$(Et3AAt# A f.HD$( A LbUIHHl$ E1H Hu8DD1HT$J|5HPD$Hl$ C,IHOt--IL9wD9l$(H|$01H)H$T$(t$8LIS|$(L;HI9:HL s  H1A3I9uԉIHHH<NLt$@D NL V41HT$(L4I1L1L sv A @AʉHH?APIM9uƅt=)ʉ?A1= D)A PHOHIT$8LH5CW 1[C.fDHT$ H5V 1舑D$1fЃ t @ADuxD$(@A@LHEH+CD(ADl$uGD$(0A0J1]GHD$0HHH@A@0A011E11H5U 1苐D$1E1DH5U 1cDH5U 1KH5 13H5 1NH5U 1D$H5 1TD$1Xgggggggggggff.fAWA-H3AVAUATUSH4 HHdH%(H$81H|$@HD$8HHT$`HL$@DHn H$HNm HT$pH m Hv H$Hm H$HH$HP H$HT$8HD$@HGs H$Hvn H$H HD$PH$H D$HvD$X Ƅ$oDŽ$DŽ$Ƅ$kDŽ$DŽ$H$Ƅ$ tH$(HH$8H DŽ$0DŽ$@H$H虼D$t1H$8dH+%(JD$HH[]A\A]A^A_@5rH=sDFC11҉5DBH|$8H1HT$4H5R JdD$4D$x9Ll$8LBH; D$ IE HD$(H$11E1HD$ L5p HD$,H|$DHGHD$H9l$ ~QAt- LAAA=!ExHoAL)EA CEǃH9l$ EtHD$H|$ HH)9DN$t A@sH\$ DH;H9Ll fH1A3 H9uAȍFF < F D9T$DH5 1=CKAOf|$uaLl$8LAHg(H5 1D$AfD$T$H5 1@T$H5P 1D$@Ll$8L@HSH5j 1膊D$fLl$8LS@IU HT$(D$ a1HT$(H5} 11D$cH5 1D$C@E15DH5V 1D$HT$8H5O 1轉D$H5FO 1蝉D$DH5wO 1zD$D$hHt$ZfAWIAVIAUIATUSH8dH%(HD$(1HHHHL$1HT$$LD$ H55 dF HT$LLMIHHcL$t$ H|$$CIH1UOH5 LD$bGHHHMHH 1ME1L"E|$NHEHGLGLGHD$(dH+%(YH8D[]A\A]A^A_98HMtF8H|$P.(fH5 1qAMtLr/H$HdH+%(RHXD[]A\A]A^A_fD@Ha(H5 1.D$,IHoLt$@L$HD$ HHD$8D$(Lt$pHD$LLU5H LD$(j/HHfHxH5 H|$f#HT$H|$Ht$N ATUH-8L SH] HdH%(H$x1H|$Ll$HH HT$hHHR HL$0H `M DHL$@H K H$HT$HL$XH BH$Hk5 HL$xH W5 H$H(M HD$ H$H\$H$HH$HB5 Hl$D$vD$( D$`oD$pDŽ$Ƅ$rDŽ$DŽ$Ƅ$tH$HH$H` DŽ$DŽ$H$KAE1t9L *H$xdH+%(HĀD[]A\A]A^H=Ht$GuAąH|$Hu$H{HHHHtH;.u{8tL$Ld$LL.H5> L.35"H="6-IH11H~$Aą|$t+fOHH HL;OHH(HuH5 J 1kE1D1Qf 8`HH5K 1j`8HÁ&HH5W 1jD#A's(l(LH52 1tjE1A!)HuDH|DHuDHTDHbDDAUIATUSHH-dH%(HD$1Ld$LHs|$HLHru|$u̻HmH@Ht!HT$dH+%(uGHL[]A\A]fHD$dH+%(u&H[]A\A]DHv'DAUAHZATH5UHdH%(H$1HXU H$HD$HD$1L$HH X H$H5H H$ H5F HG H$8H5F H=H H$hHL$H$HH5SH$H 1 H$HM H$XH56 H$HL$H$H$H5_F H$H$H=q0 D$HD$ Ƅ$vDŽ$ Ƅ$@oDŽ$PDŽ$`Ƅ$nDŽ$DŽ$Ƅ$fH$H * H$HL$ H$0HL$!H$xH * H$H5* H$HL$"H$H=* H$@H5* H$H H$XH= H$H5{/ H$HL$$H$ H$hH$H$H=F H$H$H 9 DŽ$DŽ$Ƅ$NDŽ$(DŽ$8Ƅ$`pDŽ$pDŽ$Ƅ$sDŽ$DŽ$Ƅ$tDŽ$DŽ$H$DH$@HH$0H|$H$PH%Z Ƅ$8tDŽ$HDŽ$XH$`:nŅD$$H|$?Dl$$LaIHLLH(Vf)D$@D$HD$)D$PD$LD$$)D$0D$PD$TD$ Ld$8D$XD$"D$@0fD$YD$!D$[HD$HxHt$0 AŅH= (,fDH5! 1dH|$?11*ŅHt$`+AŅM|$$L$L9LM%IHEAE1L#Hl$Ht&EtYuH}sH} (H#H$dH+%(THD]A\A]K@}+fD8IHT$H5P H1cEmAf@H|$0D$Dzf.Af.[89LHH5+ 1&cNH=~ E19@ H5+ bE1AA8HT$H5f+ H1bE1AAR!I<I<I<I<<I<I<I<DAWAIfAVHN AUMATU͹ SHH |$L$H$Ht$H5Q dH%(H$1)$HDŽ$HD$XHLH$HH$H^A H? H$H? H$H$H? H=! H$H%H$HE H$H H$H5b H$HE H$H$0H$Ƅ$vDŽ$ Ƅ$oDŽ$DŽ$Ƅ$8nH$`H5 H$H$H$H5 H$H$H$H5Y) H\$H$PH H$H5) H$(H$H$xH H$8H5) H$pH$H$@H$H$H$H$PH5( H$`DŽ$HDŽ$XƄ$sDŽ$DŽ$H$Ƅ$cDŽ$DŽ$Ƅ$zDŽ$ DŽ$0Ƅ$XyDŽ$hDŽ$xH$H H$H \= H$H5 H$H$8H$H$H$H$HH ' H$H=' H$H5 H$XH$ H$H= H$(H5 H$H  H$H$pH= H$H$H5 H$H$"H$Ƅ$rDŽ$DŽ$Ƅ$dDŽ$DŽ$Ƅ$0MDŽ$@DŽ$PƄ$xpDŽ$DŽ$Ƅ$mDŽ$H$XH$(H$hH H$xH$0H$Hv H$H$$H$H$1H$ H  H$H$2H$H= H$H5 H$0H C H$@H H$HH= H$H5j H$H / H$hH$3H$H$H=x H$ H5 H$PH z H$xDŽ$Ƅ$aDŽ$DŽ$(Ƅ$PgDŽ$`DŽ$pƄ$lƄ$fƄ$(CƄ$pTDŽ$H$H$4H$H % H$H$6H$H$7H$`H% H$H$8H$H= H$H5$ H$H$9H$H $ H$(H= H$@H5$H$H9 H$pH $ H$H= H$H5; H$H$:H$H$DŽ$Ƅ$SDŽ$DŽ$Ƅ$DDŽ$DŽ$ Ƅ$HVƄ$wƄ$tH$H$8H$HH$`H$pHQH$HN Ƅ$htDŽ$xDŽ$H$AH|$XMLLbAąujD$E9HD$X8 xHt$Aą 8 HH5@ 1Y@D$1E1E1AHBL:Hl$XHtE\HH$Ht/$H$umHDŽ$HDŽ$A|$LH$dH+%( H D[]A\A]A^A_두E1$ < $6 $0fD$T$0t f fD$$1tfL$@$2tfL$$3D$H$AljD$4AA? D|$H$?3 H$ H|$`LcLLT$XLT$ 8Hl$`1H}HHEHHDžHH)HL׋$AąWUH|$hLЃ0 кHfD$HT$8E1E1AfLLLƉAąe5H= FC11҉5H $:H|$XL\Aą8'Hc I|H=w Hu H1H Z H=u T$:H / /H=^ )@|$'fDH}WH}f}w< $4f T$ D$0Uf1E1E1AD8 HH5j0 1ZUE1E1Ll$h1I}LIEIDžHH)HHD$ D$0HD$ @$H$HHDŽ$L$DŽ$0H$DŽ$D$DŽ$Ƅ$*AEED$MD$LtD$H$ t9tD$8D$D$8IHD$@LH$HD$(L9sLH5 1TLd$(H$HuGI~HIHH/HuA~8$fD$NH|$(H$ɜHD$8HH$H|$@Hu$D$HHHH9s fbH|$@ IH\$ML$LH$H$(ډL$HbAąUL$4toH$Ht$8|$DH$tFHT$@LDy28AH5 AH1RD$7u$8T$H5 1!$H5 11H5 1T$H5 1T$NH5 1LH5 1HT$8H5 1H$H5 1yT$0H5 1bH$H5 1G$$H5 1,$"H5 1$2H5 1H$(H5 1T$HH5 1H5 1$8gH$f)$PH$@H$()$`H$HHD$8L$`H$XHD$ DŽ$h`)$p)$)$HD$ @$lMH$1$p$$tD$($|D$@$D$Nf$D$f$$$f$$"f$$4f$$6$H$H$D$M$D$L$t$H$@ 1H|$pAf$9ED$45HL$H=AHL 1~f6@12D$H$1E1E1A\fD1ADžH$D$8H\$@1҃HD$(HfD$NHHHD$(DLL|‰0 HAL Ήʃ@t$Mփ@t$L@tZ|$L҃E1HH5 1MH\$@~D5IAEU ΃@t$L뇐HL$pHT$1H+$H5m Hi@BHL$xH+$'fK fDk8XHH52 12MDHT$(Ht$8|$EHPH$HT$@LDH8H5q H1LA- 8AH5O AH1L[ .H5 1cLeH=GA1H 1 H)8 wFH=0 /"H5 1LD$1E1E1AA[E1AM PH=0 q/N8H5 H1KAH%H%HK&HU&HD&H'&HT&H&H&H &H$&H%H%H%H%H%H%H%H%H%H%H%H[%HO%z%h%H1%H;%>%H!%ff.IH H5 ff.@IH@ H5J7ff.@IHx H5 off.@UAI˹cIH5P) fHAWAVHLAUATSHHdH%(HE1H5 ƅH1HH HHn' HH +' H52' HH ˓H=G HH- HH58 HH  HH(H5 H@H HDžHDžhDžHDžHDžƅvDž ƅoDžDž )pƅHOH`HHHHHHpH5C( H8H/ HH HH5 HHHHH  HH5 HHHPHHHH  H(H`H= HpDžXDžhƅnDžDžƅlDžDžƅ mDž0Dž@ƅh0DžxDžHH5$ HH= HHHH [HHHq& HHH_HHhHDH LH8LHXHi: ƅ1DžDžƅiDžDžƅ@tDžPDž`HhLNAą1HAlj\ADE?F8E1HHd1PE11jDLpjjAVWHhjjPPP PjaAHp:<Lp,LhMt1AuI~LpBI~LHpHt/xHlHDžpHDž\HEdH+%(dHeD[A\A]A^A_]@LpLqIH E\HH}fDž\\ g:fDd޿LpG(H5 AHD1A[d|EH8MlLLp5 RD1Lpj Aƅ\fD HH5 1dA~Lp 8)HH5s 1LpBff\LLpHnH=7 ]s8AiH5 AH1@B-A"HD\AH:jHcH H } ;ff.H ff.HH=qdH%(HD$1Ht$J1u 1|$@O%Ht*HHtHT$dH+%(u#HHD$dH+%(uHfDHH=dH%(HD$1Ht$J1u 1|$@$Ht*HHtHT$dH+%(u#HHD$dH+%(uHFfDAWAVAUATUHHSH(Ht$dH%(HD$1IL1H)ڍuMLl$HLHAMHH!HD$HHIHuGMDHt$HHV1LHH!HHD$袺IHLNLHuL9t$AfDH|$IL1H)ڍuHLH]MDHt$HHV1LHH!HHD$IHuH|$11tH)΍ 2uHT$H HD$dH+%(u4H([]A\A]A^A_L9|$ 1T1?ff.fATUSHHHt }HHǃHt }HHǃHt}tQHǃHHkH{H Hs@HC8H9tHX}HSHsH[]A\4@H}HMH}uqH9f@H}uH!-@LeA<$uI|$aLLeA<$uI|$LLeA<$uI|$LLeA<$aI|$uzLLDLeA<$uI|$LiLeA<$I|$uRLJDI|$薺I|$茺EI|$vI|$lmI|$VI|$Lf.I|$6I|$,VI|$I|$ I|$I|$AUATUHOHHAHI1LH5` H1L-!HiHLDIH57 1u ]A\A]fDHLDIH5 1H]LDIA\H5 1A]AWAVAUATUSH8H|$(@t$_HaIƻfDL0HH&HH= 8|$-HHHH!IHHl$E1Lt$ LAtLILHD$LH$0LHLIzHILHt$H¿1VLL$H5P oXLZHIHvHl$Lt$ EtWHL,HHt D1H|$(LIHH8[]A\A]A^A_fDHhIHtLLIMLH2LIMILHH5 1LHmIHu9UHAWAVAUATSHH $HH $H@H$ E1E1L;'dH%(HE1ALIH@H@HHhL@L@HXHHHHLHHH߹H@H@HHHLH HLH0H1H@HH f:HH@HF H  fDL HpHPHDžpDžHDžDžHDžfD(ƅ8ƅ<ƅHvDžX H`H HpH# HHʁHH HH HH & HHHHH8H HPHH 8 HHHN HH  H`H HHLL HH(HpLL= ƅoDžDžƅnDžDžƅ dDž0Dž@ƅhsDžxDžƅbHHHLLr LL HHL L L8L' HXHLhL` LL' HHLLD LLH HHLL: HHHLL H H0HDžDžƅNDžDžƅ@ODžPDž`ƅlƅfƅpDž(Dž8L@L HHHH HH ` HHHH HH  H0HHPH H`H  LXL HxH HhHxDLL@HH@Hƅ`PDžpDžLƅrDžDžƅRDžDžƅ8aDžHDžXƅADžHH ( HH0H(Ht H8H HPH8HpH HHn HH HH:HH(HHL HH HH HH HHH fH5J 1AFt+1H-9 @AT H1HA9^w AE9HD$@D9H[]A\A]A^A_Hh |HL pH3 dH XH Lff.AU1H5& ATUSHHDg-C`AfAd@[fH5z *Y Y S1H5% #SH51& 1L%O L- KMH-2 H6& HMD1eK MHHE& MD1BKMHHR& MD1KMHH_& MD1KMHHl& MD1KMHHy& MDH1[]A\A]@ fkfH6 HcH>fHq" fH5 1=Ht$ 1fH5 H5 1fH=" HD# HD3fDH! HA" t@H " d@H THNF HAWAVAUATUSHt$ #H_0E1L=r H- L-* fDSHЀ<IcDL>DH fLLs1 SH % L$ H5 ШLDH H% HD1̾HS1H5 赾HS1H5 螾H5 1苾AH1IqI9u AH@D9d$ H[]A\A]A^A_H ڸ @H @H W @H H <{H HBSH5@$ 1H5_$ [1骽f.ATH5s$ 1USH耽S1H5~$ iC<tY<t}tit@1L% & f.HLHHLHTDD19+w[]A\fDH=a$ f.H=$ fH=$ vff.@SHi >HH[ HH5'^ HD1荼[AWAVAUATIUSHh x@wH… HcH>@|$ T$ HM[H]A\H5= A]1A^A_@DH5V= H1[]A\A]A^A_̻@DH5.= 1 读DH5E= fDDH5< 1A{H At,AH EtAH H HDH5k< H1[]A\A]A^A_!DH56; 1H55 1H5=; 1AH" H HDп1AH5A; 贺H At,A HD EtAH' H HDH5<; 4DH5^9 1 LDH t'<? H t<H H HDH599 11H5O9 Au HX uH} H5X9 1輹H=u9 AH59 AH H HDH5 CfDH5 6 1eH AH> HEH56 1H-p 2D1H566 D1 H5b6 H56 1AHF H7 HDH5 1軸D1H56 蟸H56 1茸AHH56 HEӿ1nH56 1[AHH5%7 HE H1H H51 *L1HH51 H51 1AH H* HDH51 HH51 H H5x0 1讷D1 H50 菷DH50 DH5. 1\1H5/ F~ d  H= / /DH5/ $R H54, 1 Dă<B H€ HcH>HH5( H wHH5( H d H50) 1脶D1 H5X) HdD1H5`) HDH5) H1(DH5) H1DH5) H1DH5)* H1ȵDH5Y* H1訵DH5* H51 1~DH51 H5f1 sH50 1A=H At,AHͷ EtAH HX HDH50 H5j/ 1H5/ 1ʹH5/ 1躴AH H HDп1AH5/ 荴H At,AH EtAH H HDH5/ H5. QH5% 1AAT$H5% HH5l% @@H H HDH5# 1H-$ Hu 踳A HH5$ HEӿ1蚳AHH5$ HED1v1H5$ ` H= JAHL H@ HDH50$ 1AH H# HDH5<$ H H* H5! HD1迲DڿH5;! 1蟲D1H5S! D|1H5h! csY9H= MD1 H5Y! !wH= D1H5r!  ձDH t!H tH HG HEH5c! 1菱AH< Hh" HDH5j! 2HH5 #HH5D HD[]A\H5 A]A^1A_ IH- HP) I8HH54 A HE1AHH5W HEӿ1ϰAHH5q HEӿ1豰AHH5 HEӿ1蓰AHH5 HEӿ1uAHH5 HEӿ1RLڿH4H5 1 .L1H0H5  LH(Hu %tHr <@tHw L1DL$ 赩1LH55 蟩|$ DL$ uiEt{AE؃(=IrhA/H L1DL$ L1LH5 6|$ DL$ tDLDEuAAH[]A\A]A^A_@IcHfEtAU؃(wIr AD@I MI Iu @A@AH)t HcH>A HLbE1,S@t4AA`A6H5 1 fASH5y% 1šHS1H5% 计CS H5% 1茡CxHSH5% 1iC]SH5% 1FCBS1H5% #4? 茱SH5u$ 1@H[]A\A]A^A_ÐH5# 1轠H5 1蝠H5# 1}{C1 覰H57 H1@%ff.SǃtSu.GAH HH=31[vfDH=A1H$ [P1AH* H8)HH=¤1[H fD蓫Hff.UH=HH蒡H aH= e]ff.fAWAVAUATIUSHH=# H<AŃD$FAEŃ@0 İE H5# 1蕞AljAAfAAfLU EA׿L  LDD$H5# IE1=T$L L LH5# IE1 脮S1H5# CAlj‰AfAfL  Lr MH5# ME1L蚝L ~ EALL: IEH5# 1kSH5# 1ISH5W 1'K EHM H5K 1KHW H5< 1ԜKH7 H5 1诜KH H5 1芜KH H5 1eK H H5 1@K$H H5 1K(H H5^ 1S,1H5p S01H5h ɛS21H5_ 貛ES4H5T 1蒛TDH5k 1uS1H5[ ^S1H5S HS1H5L 2K Hi H5} 1KHs EH59 1KHJ E H5 1蹚KH!  EH5 1苚KH EH5 1]K H EH5 1/K$H EH5S 1K(H} EH5% 1әS,1H5M 轙S01H5E 覙S21H5< 菙S41H5- xS4AA]EHF AֿH  H5$ HD19L E1@9fIADH5" 1AD$AID9|@D9L EGH LDEuIDH5< 1踘fDD$uHH[]A\A]A^A_fH= 蔪S;H= |@H= dHH[]A\A]A^A_U$ DH5 1L$L$B@H5 1Dҿ1DD$H5 ͗DD$QfAWAVAUATUHSHHdH%(HD$85D$HH9B@AL1HB@HD$LADt$EDMLEHMHUЅw<H5 H HDAH=,c EJcH>f.L fH1VH5u ؖDuH Hy HD$(DeH HD$0H" EH5y HT$ HD$8XHu HIY1{A!AAEt }.Hl$A9HD$8dH+%(UHH[]A\A]A^A_f.L  @L @L @L @L @uHVuVH5^ P1螕H 8DH= 蔧"AH5 1JT\DH5V HT1/f.H5; 1 HA!! H= L @L ߡff.@AWAA@AV@1AUEATAH5 ULESHDt$HAPEtXZ2HtoHDH[]A\A]A^A_g DuH5 1L- DEfEtL]L1HI9uH[]A\A]A^A_ftlu7AtAAH 4H= H ٘H= H[]A\A]A^A_ũDAtH 5H=b L%[~ H=u MEH LHEL= 1LL5 ELLHEӿ1L- ELLHEӿ1L%1H ŒH= ɤE LLHEӿ1蟒E LLHEӿ1腒E LLHEӿ1kH=< oE@LLHEӿ1EE@LLHEӿ1+E@LLHEH1[]A\A]A^A_UH5= 1U1H5W ґU1H5x 軑U1H5 褑U1H5 莑U1H5 wU1H5 `UH5% H1[]A\A]A^A_;AH55 ff.AWAVAUATUSHH(/AăD$AD$H5 1ϐH1H5 蹐HS1H5 袐HS1H5~ 苐S1H5 tESH5^ 1TS1H5N =S1H5F &S1H5V S1H5~ S1H5j S1H5b ʏS 1H5Z 賏S!1H5 蜏H^ HD$S"H5 1yS$1H5 bS&1H5 KS(1H5 4S*1H5 S,1H5 S.1H5 H{8Hs0H H 'H5 H1迎C0- SJ1LshH5 Hkx薎SL1H5 L- ySP1H5 bSR1H5 KS\1H5 5Sc1H5 Sd1H5 Sf1H5 H5N 1ݍDAL1IL9u L+H5 1蘍UL1HyI9u DH5 1MS1H59 6S1H5? EVSH5M 1H HD$SRH5Q 1܌CE1L= L5W Ń@0 @H݉f.FD9H5A H HDt$At#H AtAH H  HEBAFVLPA1D(^_EURID9DEcD9H HDD$HBLFFP1ċZYHm HD$CAAfAAAL| EAտL=/ LH5 IE1fLM EALH5 IE1> 贛S1H5d D{DDEEAAAAAAAAѿDL$L5 L-v DD$MH5[ DT$ME1L蠊T$LH5 IE1T$LH5 IE1^ELAIEH5 1=T$LH5  IE1 蒚@S1H5x CAfA@H @տH H5 HD1詉H At/H At"H AtEH } H HEAH5 1V ̙S1H5 5{S1H5 {\S 1H5 { ܯS!1H5Q Ոk!AAAƃAAEH AտH H5- HD1肈@Hf H % HD@տ1H5C VH At"H AtEH H HEAH5T 1 膘qD$t8|$t1H=e H(H[]A\A]A^A_ fDH([]A\A]A^A_ÐDkDDEEAAAAAAAAAAEL L L 1H H5 1D\$DT$L= *EAH Z IDH5 1L5~ T$LH5 IE1݆EH H HDAտ1H5 豆T$LH5 IE1萆 S1H5r oS1H5i XDkEAH5 1AA&AH H EAֿHDH5 1D1H5 ݅ SS1H5 輅H~ HD$H5~ 1蒅DS@H5r 1qSB1H5b ZCSFH5d 19SH1H5T "hDп1L$H5T DL$DD$DT$DL$DD$DT$L$A׃tYL r H f IDLS Wп1L$H5 D\$DT$聄L$D\$DT$L  H IDMH5n 18SDH59 1H5^ 1NH5! 1 AW1H5 AVIAUATUSHB HH|$誃A1H5( 蓃H蛕A>M1L= L5 L- L1OH߃IPAT$L1+AT$L1AT$H5 1AT$H5 1I|$It$H H H5 H1贂I|$It$H H hH5 H1肂H芔HD$9 H[]A\A]A^A_ff.AW1H5 AVAUATUSHHH|$ ;H1L=r L5 L- L% D L1H؁H{HsH H LH1誁H{HsH H `LH1|H{HsH H 2LH1KHD$9KH[]A\A]A^A_ff.SHH5> 11H5a S1H5a ՀS1H5h 辀S1H5b 觀S1H5e 萀S1H5d yH{(Hs H H /H5V H1IH{8Hs0H H H5? H1H{HHs@H H H5& H1H{XHsPH H H5 H1H{hHs`H H oH5 H1H{xHspH H ?H5 H1YHHH H H5 H1#HHH H H5 H1~HHH H H5 H1~HHH H gH5r [H1~AWH5 E1AVAUIATU1SH HxD5bdH%(HD$h1A1~HcMd A|$EA$<<<pAoD )D$@H5B 1}L|$@Ld$PAH޿1I}M9u ADUHD$hdH+%(Hx[]A\A]A^A_f<Ed AԿ1AH5p 7}DH5# 1HL$}A$H5 1|AT$1H5 |A$HL$<w1<9<uEAoT H= )T$@轎<uH= Ed 蚎3DED$ExID HD$8H5 1S|L|$8Ld$@fAH޿1I)|M9u A 蔌{AoL Ld$H|$PL)L$Pz|L1AH5 {5fAo\ Ld$H|$PL)\$P2|H= 覍@ID H= HD$8芍耈AWIH= AVAUATUSHhfHt$\$$JA1H5 #{AWH5 1 {IO1H5 zIO(1H5 zIO@1H5 zAWHH5 1zAOJ1AWKEGIH5 }zAWLH5 1ezIGpHD$ AWMH5 1L%5zAWNH5P 1zAWP1H5 zAWT1H5 yAWX1H5 yAW\1H5 yAW`1H5 yAWdH5N 1yAWoH5G 1zyH|$LyL1H5? WyAH5; 1H5" 1vvA?H5 1[vA@H5 1@vABH5 1%vADH5 1 vAFH5 1uAHH5 1uALH5 1uAPH5 1uARH5 1uATH5 1juAVH5 1OuAWH5 14u$!AXH5 1uA\H5 1tA`H5 1tAdH5 1tIxIpH H p H5 H1tAH5 1ot$AH5l 1ItAH5b 1.tAH5X 1tAH5N 1sAH5C 1sA H59 1sA H5/ 1sA H5% 1sAH5- 1rsAH5" 1WsAH5 1-'H5 1}oHD$L<$H!HhI 1[]A\A]A^A_DAGLAʼnʼnAA@AA%L EAտH / H5 IE1L-s n@HZ H L HD@տ1H5" H-: nLHEH5 1nELAHEH5 1jn ~AWMH5 1HnAWNH5c 10nAWP1H5 nAWT1H5ڶ nAWX1H5Զ mAW\1H5ζ mAW\Lx H5} AщՉ AAAAD$ A AAADL$8D$$AA AD$( D$, D$0D$4D$He IEH1mDL$8E#Hd H H5 HD1l{#H-d Hy EDHH5 HE1lEHDHEH5 1lEHDHEH51 1elT$ HH5o HE1ElT$$HH5 HE1%lT$(HH5 HE1lT$,"T$0H-c H HH5 HE1kT$4HH5 HE1kD$" |AW`1H5 ~kAW`ЉՉA AAAD$A AAAAAD$ AA D$$ D$(ЃD$,D$0D$4D$8D$<D$@D$DD$HD$L D$P Hvb H . H5 DD$THD1cjDD$Tn H-=b EH DHH5 HE1(jEHDHEH5  1jEHDHEH54 1iEHDHEH5L 1L%&oiT$HH5[ HE1iT$ HH5s HE1iT$$HH5 HE1aiT$(HH5 HE1AiT$PHH5 HE1!iT$LHH5 HE1iT$HHH5 HE1hT$DHH5 HE1hT$@HH5  HE1hT$` pAH5 1`AH52 1_ tpA1H5ª _AÃH ӿH @ H5  HD1_ pA 1H5o u_A Ã@HEW ӿH H5 HD16_ oA H5 1_A H˿H5 H1^ ^oA H5 1^A HÖ˿H5 H1^ oA Ã3H ӿH  H5l HD1I^ nA H5. 1$^A 1H5!  ^A ÃfH ӿH H5 HD1] ?n9f.AÃH5 1] mAH5} 1Z]AH5 щ11]؉H5 1] mAH5 1\AH5 щ1\H5 1\ mAH5 1z\AH5 1`\AH5 1E\AAAAʼnfAAfAD$fAD$ff\$ D$$f@f\$(D$,f f\$0D$4ff\$8D$[fEHT$HDH5 1|$ HT$$HDH5 1Zf|$(HT$,HDH5 1Zf|$0HT$4HDH5 1Zf|$8HT$WEEDEAAAAA H-N EAԿH HH5 HE1VEHAHEH5 1VEHAHEH5 1V gAH5v 1{VA1H5i `VEDf AL% H- HN DEHEADDLAHEHAAP1UA[XAu dfA1H5 UAЉAЉAĉD$$AAEAD$(AAD$D$,D$ AʼnD$0AD$AƉD$4A E DL$8H ӏ H5 1UDL$8EHL DʿH H5 HD1TELy DH L H5 IE1TLO D$iL1H5 nTT$  H  H5 1CTEH'L DH ގ H5 HD1TH5 1TDL$E%EHK DH H5 HD1S  ~ 1H5~ 1S dAWL % H XK H5[ AމAAAAAAAAAAA@|$DD$IE1SEL H + IDA1H5 R@DD$ L5J EAпH-b LH5 HE1RELAHEH5 1xRELAHEH5 1WRLHEH54 18RT$LH5Q HE1R bI IH-G H H HH1QH=8 cI0I(H H kH5 H1QI0I(H H 5HH1SQH= WcA8H5 1-QA8AuA<H5 1QA>H5 1PA?H5 1PA@H5 1PAB1H5t PABÃfH-kH fL ' HH5& IE1VP `ADH5 11PADH1˿H5 H1P ~`AFH5 1OAFH˿H5 H1O 0`AHH5 1OAHH5 AAAA։AAD$HuAH A1ADD$AA)OL ։ ۉLH5 HE1ODD$DT$EH-F EH DHH5 HE1NEHDHEH5 1NEHDHEH5 1NEHDHEH5' 1cN ^@D$Hh[]A\A]A^A_fDtMEtDL$S1H5 >S1H5 >S1H5 >H{(Hs H H 0H{(Hs IH H CLH5 H1Z>H{8Hs0H H H{8Hs0IH H LH5a H1>H{HHs@H H H5_ H1=H{XHsPH H H5J H1=H{hHs`H H eH56 H1=H{xHspH H 5H5# H1O=HHH H H5 H1=HHH H H5 H1 H16AUH5A 16AԿ1H54 l6Hڿ1H5/ V6AEMlHD$D9;H$dH+%(uH([]A\A]A^A_!CAUAATAUSH H t"cH tHo0 H HDDoAAUIUIDH5 15H[]A\A]DH0 Hj HDfAWAVAUATUHH SHHcH>HA) Hrw HDH5 15HH5d 1E1L%e L=q 4LL5 FfDJ\DL1I4LFL1H4Hڿ1H5y l4LtFI uH[]A\A]A^A_HtHH[]A\A]A^A_@H5 H1[]A\A]A^A_4Hp H p HDH5D H1[]A\A]A^A_3AADkDH5 H13IkHDH5 [H]A\1A]A^A_p3H5' HHHH[]A\A]A^A_c@HY' Hu HDH5Y 1L-5o L%)o 3LIEH5N 12LIEH5y 12HkU H5 12U1H5 2U1H5 2UH5 ^L% H-׆ LH5q HH1N2@LHEH5 112 LHEH5 12LHEH5 11LHEH5 11LHEH5D 11LHEH5o 11LHEH5 11LH5 HEH|m Hzm HDH5 iH]m HQm HDH5E 1"1H5R H5 1kd0H5 H52 10H5S H s H$ HDH5 H$ Hr HDH5 1o0H5M kdC^hH5 H@110H ^ ƒt<H c H* HEAH5 A1/AD{DH5 H1/IgHDH5 [H]A\1A]A^A_/?1SH5 }/HHH[]A\A]A^A_oHjk Hhk HDH5 WHIk HGk HDH5K 6ֿ1H5& /H5G H5 HzL%j }Hj LH5 HE1.}LH5 HEӿ1.}LH5 HEӿ1p.ELH5 HEӿ1R.ELH5 HEWH5 1#.H5 H tH( H HDH5 Hi Hi HDH5 1-HUUH5L 1-HU 1H5L -HU(1H5R n-HU0H5_ zL%ti @H-_i LH5= HE12-LHEH5T 1-LH5x HEHHUH5 FL=6 HDEL5|g HD$L-$ L%t( H( L@H <tH <tH: Hz HDL1o,HH;l$EELLIE<tvHT1@AVfAUATUHSH dH%(H$1)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$)D$)D$ )D$0)D$@)D$P)D$`)D$p)$/HLc-LIHfH*$H3IHfH*H uV $1H D*H ك uL Q] D$ D$1f)H ك uL] ߸2ILEYHIL1I9~Ht/ III9HcHHLMl2HII L-\  $H$H ;x H߸(HL$&fMLI*AH x Ll$L$L(LHqLH&H(HLIAVALH5 19!XZH$dH+%(H []A\A]A^HƒfHH H*XfHƒfHH H*X$DHcHL I~M~ A?L< II_* ;HN H{LC< A8L IxIH 9HyHyHl$H5`LD$HH $YH $LD$H5`HyHL$1L$M@A8IxIx H5A`HL$L$H5*`A1EKH[;iH{LCHA8.IxIxH5_HL$L$H5_A1E1҄MA?nII_<;H{LCHl$A8IxIxH5>_HL$L$H5'_A1EX1҄0;MA?IIH^HHA1EMvA>xI~M~FA? II_ ; H{LCHl$d A8J IxIx. H5F^HL$L$H5/^A1E 1҄ CMA? II H]HHA1EJ MvA>! I~M~ A? II H]HH91҄ 1MmA}s I}MuA A> I~M~n A?]II_;H{LCHl$A8IxIxkH5\HL$~L$H5\A1E+1҄MA?IIHi\HHA1EMvA>^I~M~?A?#IIH\HH1҄1MmA}mI}Mu$A> I~M~ A? II^ H[HH91҄+ 1 I}HH5I[tzMd$A<$_I|$Ml$|$HR HY HDH-K LH1D$"LHRR H5! 1D$Hl$Ht}uH}Hs%HD$ 'HD$(dH+%( H8[]A\A]A^A_DHhLH5K H1D$D1.LeA<$uI|$L$LeA<$PI|$L$7LH-" 1H>Q HMd$D$A<$oI|$Ml$A}bI}MuA>I~M~0A?II_o;'H{LCHl$A8IxIxH5YHL$L$H5XA1E1҄cMA?:IIHXHHgA1EMvA>I~M~A?IIeHQXHH1҄21 ^MmA} I}Muq A>W I~M~8 A? II HWHH1҄ 1 I}HH5WMMd$A<$I|$Ml$EA}5 I}M} A? IMwHl$ A>E I~I~' H WHH1҄1I}HH5VMd$A<$ I|$I|$L-VHLQI|$HL9@1NLH- 1HM H MmD$A}I}MuHT LD$mI|$3I|$)I|$I|$HH- 1H7M H{MvD$A>hI~M~HT L1H@MmD$A}$HS L1HMd$D$A<$HS L1|$HL HS LHDH-X 1HMd$D$A<$uI|$Ml$yHKS |$H9L H3S HDH- wLH- 1H L HNMD$A?#II_HR H1HMvD$A>HR LH-t 1HK HH[D$;~Hl$|$H`K HZR HDH-$ |$H=K H7R HDH- M|$HK HR LHDH-۱ 1HBMmD$A}I}MuHl$|$HJ HQ LHD례|$HJ HQ LHDH-b 1HMmD$A} I}Mu{ Hl$|$HDJ H>Q LHD례|$H(J H"Q LHDHRHLRHP 1HH+MD$A?HP LHAR#HL1RHyHl$L$HRL$H-Q HtI 1HL$Hl$D$L$uIHHTHQHHLQ6HLQ3HLQ#IHH3HcQHLSQH{HH5@QIxHHQHLQHLP|$HٿHQO HIH HDH- 1HHl${ D$|$HH HO HHDH-ڮ 1HHl$< D$|$HG HN LHD뿀|$HG HN HDH- |$HG HN HDH-_ IHH5HO+HLOH{HH5OIxHuHOHLOzHLOu|$HٿHM HF HDH- 1HHl$ D$>|$HF HM HDH-k |$HF H~M HDH-H H{HH5N;IxHHNHLNHLN|$HF HL HDH-Ǭ IxH,H/I~HH5QN IHHH%NIHH5NI~HHHMHLMHLMMHLMJHLM:|$HE HK HDH-ū LH1) D$|$HD HK HDH- LI~HH5.M;IHHHM HLLHLLHLLIHHzbHLXHLLHH{HH5LBIxH.H^LHLNLHL>L|$HٿHJ HC HDH-[ 1HHl$D$k|$H`C HZJ HHDH-! 1HHl$D$t|$H!C HJ LHDH J HI DHLzKHl$LHeKy|$HB HI LHDH5 1Hl$D$`|$HB HI LHDI~HH5JBIHHHJHLJHLJHLJ|$HA HH HDH- L1H%Md$D$A<$ |$HA HH HDH-t LI~HH5JIHHHIHLIHLIHLIIHHcHIHLIH{HH5pI+IxHaHGIWHL7IGHL'IB|$HٿHG Hy@ HDH-D 1HHl$D$ |$HI@ HCG HHDH- 1HHl$lD$I~HH5HO%|$H? HF LHDHF HF )AWIAVIAUATUSHXdH%(HD$H1} H1H),uANXI~HHLl$@H|$AN\LHH!HD$@HHHHuJ fDANXH\$@LH|$HS1ɃHH!HHD$@HHHLHAąuHw HHHD$(HHD$ e HHD$HHHD$; HHD$HIHHxHI}HLT$0H1ARLL$0AQLD$0MAPHt$0IVHL$0H5b QLYHHD$pH0THHt*@H@LH HHHHuHZ HHt5fH HHtLHP HHuHHuLl$@D$?M+A}LI}MuA>LI~I^;H H{L{ A?L IGIHD$o HD$8H HD$HxLHr A9L IyII 9@HyCHyHl$?LL$H5EHHL$HL$LL$H5DHyHLL$LL$MIA9IyIyH5DHLL$fLL$H5DA1EIHD$HH9HyLIA9Iy^IyH5@DHHL$LL$LL$HL$H5DA1E1҄f MA?'IIO9HyLIA9aIyPIyHl$?HL$H5CHLL$KLL$HL$H5zCA1E1҄fMA?IIH50CHH5!CA1EL{A?^ II_B ; H{HK 9HyLAA8 IxIxHl$?HL$H5BHLD$DLD$HL$H5sBA1E<1҄ _H[;H{H{H5*BHH5BA1EMA?8 II_ ;H{H{.HH5A~1H5A1MvA>2 I~M~< A? II_F ; H{HK 9HyLAA8mIxIxHl$?HL$H5AHLD$LD$HL$H5@A1E1҄H[;H{H{H5@HVH5@A1E*MA?2II_;H{H{0HH57@1H5)@1MvA> I~M~A?II_;xH{H{VHH5?l1H5?"1I~HH5u?0t~MmA}LI}Muh|$?H6 H= HDH-z LH1D$?)LHz6 H5I 1D$?Hl$@Ht}uH}ugH HD$@ HD$HdH+%(HX[]A\A]A^A_@H 9 TH5{N H=w LeA<$uI|$*L! LeA<$kI|$LRHH-i 1H5 HMmD$?A}zI}MuA>pI~M~YA?II_;2H{HK29 HyLAA8hIxIxHl$?HL$H5Z=HLD$ LD$HL$H5<=A1EW1҄ (H[;"H{H{B H5@ I~M~ A? II_ ;TH{H{6HH5<1H5;1I~HH5;MmA}I}MuQA>GI~I^;H{L{Hl$?A?FII*H5I;HH5:;A1E  AE&I~HH5; MeA<$ I|$I|$L-:HLI|$HLof.1LH-٘ 1H1 H9MvD$?A>I~M~H8 LI|$nI|$dI|$UI|$KHH-V 1Hr1 HL{D$?A?`II_HB8 H1H{MvD$?A>!H8 L1HOMmD$?A}H7 L?|$?H0 H7 LHDH- 1HMmD$?A}uI}Mu~H7 |$?Hy0 Hs7 HDH-= zLH-. 1HJ0 HMD$?A?IIOH7 1HVL{D$?A?H6 L|$?H/ H6 LHD|$?H/ H6 HDH- |$?H/ H6 LHDH-[ 1HMvD$?A>.I~M~Hl$?|$?H>/ H86 LHDH- 1HfMvD$?A>I~M~Hl$?H- 1H. HHD$D$?HH9Hl$?|$?H. H5 HDH-h |$?H. H{5 HHD>|$?Hb. H\5 HHD|$?HC. H=5 HHDH- 1HHl$?fD$?|$?H. H4 HDH-Ȕ |$?H- H4 HHDH- 1HHl$?D$?o|$?H- H4 HHDH-c 1HHl$?D$?H-> Ha- 1HLL$Hl$?D$?LL$|$?H-- H'4 HD|$?H- H 4 HDH-Փ |$?H, H3 HDJ|$?H, H3 HD|$?H, H3 LHDH5w 1Hl$?D$?Hl$?LHL$H4HL$Hl$?LH4HL4CHH4HL4HyHH54Y9Hl$?LHL$H|4HL$HyHH5d4Hl$?LHL$HB4HL$Hl$?LH(4|$?H2 H+ HDH-H 1HHl$?D$?|$?HM+ HG2 HDH- |$?H*+ H$2 HDH- LHyHH53IHLHL$q3HL$[HL\3V|$?H* H1 HDH- 1HMD$?A?,H1 e|$?Hr1 Hj* HDH-0 1HHl$?D$?|$?H5* H/1 HHDzHL2A~Hl$?HH2AfHHx2HLh2|$?H) H0 HDH- L1HMmD$?A}qf.|$?Hx) Hr0 HDH-< LHyHl$?LL$H1LL$H;0 |H/0 Hl$?LHL$H1HL$Hl$?LH1|$?H/ H( HDH- 1HHl$?D$?HH;1%HL+1HyHH51ӹ?HL1 Hi/ LH1D$?lHF/ LHl$?LH0`|$?H/ H( HDH-܎ 1HHl$?CD$?,H. 6HHb0HLR0HyHH5?0HH'0HL0|$?Hz' Ht. HDH-> |$?HW' HQ. HDH- H{H耸H/IxHl$?HL$H/HL$)HL/kIyHHL$*HL$IyHl$?HL$HG/HL$H{HIxHHL$طHL$IyHHL$躷HL$IyHHL$.HL$H.LI~M~A?L"II_;HH{HKs9= HyLA+ A8 Ix IxHl$H5(HL$HL$`L$HL$H5(A1E HyHH5i($H[;D H{H{( H59(HH5*(A1E [MA? II_ ;| H{H{` H5'H荰H5'A1EH IHH5'ZMvA> I~M~ A?v II_Hl$R ;9 H{H{ H58'HH5)'A1E ZIHH5'软?MvA> I~I~ L=&HL膯A1EN MmA} I}Mu A> I~I^T ; H{L{Hl$ A? II H59&HH5*&A1Ez [H{HH5&辮@MvA>6 I~I~ L=%HL臮A1EMmA}I}Mu@A>&I~I~ L=p%HL%A1E1҄ Md$A<$I|$Ml$A}sI}Mu A> I~I^ ;t H{L{Hl$P A?6 II H5$HfH5$A1E H{HH5x$3MvA> I~I~ L=G$HLA1EK mMmA} I}Mu A> I~I~ L=#HL蚬A1E1҄}Md$A<$I|$Ml$RA} I}MuHl$A>I~I~L=T#HL A1Ew1҄OtqMd$A<$!I|$I|$L-"HL贫t:I|$HL蠫(fDLHB H5 1{D$Hl$Ht }fHD$ HD$(dH+%( H8[]A\A]A^A_DLغLD$LHHH1H}tH}9H}0HS1LH-, 1HH HMd$D$A<$I|$Ml$H LD$LH- 1H H-MmD$A}I}MuH L1HMd$D$A<$H LH1D$CHH-9 1HU HMvD$A>I~M~BH% L1H^MmD$A}H L;H-~ 1H HMD$A? Hl$>|$H H HDH-m~ |$H H HDH-J~ |$Hc H] LHDH-$~ 1HMd$D$A<$I|$Ml$|$H H LHDI~HL5He HLUHLEH 1LHMvD$A>H LVH@HL0IxHl$H $HH $IHl$LH $HH $,LH-| H 1HHl$FD$ HtHHdHHT|$H H HDH-{| H{HHHHIxHH $諦H $]I}HH5茦I~HLurHhHLXHLS|$H LH H5{ HD1Hl$ D$I}HH54hI~HLإD|$Hx Hr HDH-<{ LH1D$I~HL臥HHLIHVrHhHLvXHLfc|$HٿH H HDH-z 1HHl$D$,|$H H HHDH-Kz 1HMmD$A}uIHl$9|$H@ H: LHD봀|$H$ H HDH-y VH |$H H HDH-y I~HLHKHL;H{HHHH HH|$LHV HN HDH-y 1HHl$D$|$H H HDH-x |$H H HDH-x eH{H$HTHLDvHL4q|$H H HDH-Yx 1LHMd$D$A<$DI~HL蔢HHLIHc HHLHLs|$HٿH H HDH-w 1HHl$D$|$H H HHDH-Xw 1HMmD$A}u&Hl$|$HM HG LHDH7 I}HH5jXmff.fAWAVL5S AUATUSHdH%(H$1Hl$ HxL1LV H [ H5b Lm H5c 1LL¿ML$MsA}]I}M}&A?II_M;LH{LCeA8KIxMHA9*IyMQA:9IzMZA;I{I{H5ʳHLL$LD$LT$L$L$LT$H5LD$LL$I{HLL$LD$L$賟LL$LD$L$LL$L$GIzHH5F聟LL$L$#MIA9:Iy(IyH5 HL $LD$;L $LD$H5A1EL"f.M@A8IxMH[A9IyMQA:"Iz$IzHLD$H5jLL$L$蜞1L$LL$LD$H5C%1!IxHH5RfH[; H{LCA8IxMH{A9IyIyH5HL $LD$L $LD$H5A1EptpIxHH5o誝tYH[;a H{H{ H5CH{H54A1E"1 fDHL H5 L Ƞ PHŠ L0o AVL5 H PH LH57 PH PH P1H0LLATL T 1ATMH59 ATATATATL$ H0MrA}\I}M}A?C II_ ; H{LCTA8 IxMHA9IyMQA::IzMZA;I{|I{H5HLD$LL$LT$L$ΛL$LT$H5LL$LD$I{HLD$LL$L$蒛LD$LL$L$LD$L $FIzHH5U`LD$L $"MIA9IyMQA:!Iz/!IzHLL$H5LD$L$1L$LD$LL$H5!1DM@A8rIxMHA99IyIyH5sHL $LD$rL $LD$H5RA1EIxHH5+6fDH[; H{LC A8fIxMHA9YIyIyH5HL $LD$™L $LD$H5A1EltpIxHH5芙tYH[; H{H{H5SH[H5DA1E fDHL Hk LL PH L PH H5 1XZATATL [ LLH5 Mȿ1L$Y^MA<$qI|$Ml$ A}I}Mu& A>|I~M~mA?#II_;H{LC|A8IxMHA9IIyIyH5sHL $LD$L $LD$H5RIyHL$躗L$M@A8IxIxH5 HL$~L$H5A1E5H[;H{LCA8IxIxHH5L$1L$H51DMA?II_;H{LC6A8mIxIxHH5L$1L$H51-IHH5? MvA>2I~M~#A?MII_r;H{LCA8IxIxHH5?L$趕1L$H5)1thIHH5ztQMvA>u|I~I~L=HLKA1ESHLHH$dH+%(wH[]A\A]A^A_@HLetMmA} fHLEtMd$A<$uI|$Ml$4A} I}MuA>I~M~A?II_;H{H{H5H1H5A1EIHH5MvA>I~I~L=RHLǓA1EfDMmA} I}Mu A>I~I~L=HL_A1E!I}HH53Md$A<$I|$Ml$A}4I}MueA>I~I~#L=MHL’A1EI}HH5薒iMd$A<$NI|$I|$QL-HL[.I|$HLCfDHHMA?HLťMmA}I}M}_A? II_F ; H{LC> A8 IxMH]A9IyIyH55HL $LD$dL $LD$H5A1EIxHH5(H[;# H{H{zH5HH5A1EDMA? II_3 ;H{H{H5TH茐H5EA1EIHH5YfMmA}I}M}A?H II_y ;cH{H{H5HH5A1E_}IHH5|跏bMmA}HI}I}nL=JHL*I}HLhHHE MA?HLMmA}I}M}wA?=II_;% H{LC A8 IxMH A9 IyIyH5HL $LD$茎L $LD$H5lA1E_6IxHH5EPH[;{H{H{-H5HH5A1EDMA?*II_{;M H{H{H5H贍H5A1EQgIHH5v聍KMmA}1I}M}A? II_ ; H{H{ H5HH5A1EIHH5ܻMmA}I}I}nL=HL诌zI}HL蘌fHLuSHL5#HL;HHE#HL{HH+II_tŀ; H{LCA8IxMHA9 IyMQ A:7Iz"IzHLD$H5LL$L$襋1L$LL$LD$H5|_13AIxHH5P[&H[;6H{H{+ H5 H(H5A1EMA?II_; H{H{ H5HĊH5A1EwIHH5葊_@II_9;pH{LC!A8IxMHA9fIyMQ A:IzQIzHLD$H5ǝLL$L$1L$LL$LD$H51 uIxHH5t诉ZH[;H{H{ H5DH|H55A1E@ MA?:II_;mH{H{1 H5ܜHH5͜A1EIHH5@I}MuyA>I~M~A?JII_/;H{LCA8 IxIxHH5L$S1L$H5=1| IHH5MvA>-I~I~# L=gHL܇A1E MmA}I}MuRA>I~I~VL=HLwA1E 9I}HH5KfDHL%HLHL՚HLŚHLHLeHL蕚HLEHL襵0HH%hHL腵`HLE0HH5 HL0HHEHHXHLL$!L$`HLL$ٙL$HHHH赙HH襙HLU HLEHH襴HL%HLL$聴L$HLL$9L$`HL%HLHL50HLHLXHLHLHLLL$L$謘L$LL$fHLLD$L $躳L $LD$eHL12HL葳LHL聳HLATHLnHL!HL9HL1HL}HLHLLL$L$ȗL$LL$HLLD$L $ֲL $LD$HL荗HL="HL蝲HL]HLMHHHHjHHEHL=HL-HLHL HLLL$LD$L$迖L$LD$LL$GHLLD$LL$L$ñL$LL$LD$H(HHޒGH`HHH誒H蝒xH萒WHCH6H)H茭BHdI~M~A?II_;H{LCA8IxMH+A9IyIyH5KHL $LD$vL $LD$H5*A1ETIxHH5^v9H[; H{H{H5ӄH+vH5ĄA1E MA?}II_;H{H{H5oHuH5`A1EIHH59u@kMvA>I~M~A?II_;!H{H{H5ӃH+uH5ăA1EIHH5tMvA>"I~I~L=lHLtA1ErMmA}QI}MuA>`I~M~A?II_;7H{H{H5قH1tH5ʂA1EIHH5sMvA>I~I~L=rHLsA1EMmA}u[I}MuA>RI~I~L=HLis1҄q1DHL݁tMd$A<$tUDHL轁HH$dH+%(NH[]A\A]A^A_@HL}I|$Ml$tA}PI}MuaA>wI~M~A?II_;nH{H{H5HXrH5A1EIHH5ʀ%rMvA>I~I~ML=HLqA1E MmA}VI}MugA>;I~I~L=7HLq1҄1fKMd$A<$0I|$Ml$_A}I}MuA> I~I~ L=HLq1҄1^I|$HH5qpHLU軱HL=[HL%HLHLHH~HL~HH~HL~CHL~ZHL~HL~HL~*HLu~rHLe~HLU~HLE~HL5~2HL%~HH~xHH~;HH}RHL}XHLL$}L$HH}HH}HH}HH}9IyHL$x}L$VHg}HZ}HM}I}HH5:}n;I}HH5}znHL}I}HH5|MnH|HL|H|HL|H|H|;IyHL$mL$SHg|dHX|HK|H>|I~HLmH{HtmPH{H`mI~HLImII~HL2mwH{HmH{H mPH{HlI~HLlxI~HLlI~HLlfAWAVAUATUSH8H|$(t$$tHD$HHhp H|$@IH@tLӲH=p GLHHuBfHL赥HH)H!Ht܋D$$6L訢IHLd$DH|$LcIHLϨHtLBH5ho 1荟H=^o 葱L虨HHtLl$@HHI%LIzLH$辦LI裲LIHMLAULL$HH5n 1Y^HH|$BHHuLl$T$$:LLHHLd$L5n L-n DH谭IH@L(L1wH=Hn {H蓦HHD$֥HH$躱HILL$LLL$H¿1!LH֬IHzH|$HݥHHILd$H|$LϤIHt M}1Ht$H|$(7HD$H?H8[]A\A]A^A_LIHtHsm H-m HD$LLH$̰LI1L$Ht$LH¿16H=m :L2IHtDf.L8LI蝤LH1LL螫IHuLL諤IHOL2IHHl L$$HD$fDLLHLIRHt$LIH¿1XH=)l \H<$IHLHHHu^fDHL]HHtEH蝝I9uHLILIzMLHމ¿1Û멐H<$LTIHxH<$L|IHL$$1DfHHH@t(H=蜝H5u HWH=tH5  H/ff.@ǤAW1AVAAUATUSHHHt$ H51m 謚EH1L=Sm L5j L-j L%j >@<u"hH5Lk H1RH9l$ L1-QLH1;H L1tLH1ҙ6H5j H1谙H5j 1薙H H5i 1|HH5i 1bHڿ1H5i L pH5i H1*<HH5i H1H5i H1͘H5i H1諘H5vi 1葘9l$ IH[]A\A]A^A_TH]ff.UHSHH@;H5.HUH9uH[]ft@UjSHHHf;H5HHH9uH[]fDt8USH,HHf;H5H轭H9uH[]Ðff.@t8USH,HHf;H5FHmH9uH[]Ðff.@t@UnSHHHf;H5!HHH9uH[]fDUHo@SHH;H5HլH9uH[]fUHSHH@;H5nH蕬H9uH[]fUHSHH@;H5.HUH9uH[]ft@UjSHHHf;H5HHH9uH[]fDUSHHGu WWЅt#Hl;H5H譫H9uH[]ÐUHoSHH;H5NHuH9uH[]ft8UFSHlHH;H5H-H9uH[]Ðff.@t8UFSHlHH;H5HݪH9uH[]Ðff.@UHo@SHH;H5nH蕪H9uH[]fUHSHH@;H5.HUH9uH[]ft8UFSHlHH;H5H H9uH[]Ðff.@UHoSHH;H5HũH9uH[]fUHSHH@;H5^H腩H9uH[]fUHSHH@;H5HEH9uH[]fUHSHH@;H5ޗHH9uH[]fUHSHH@;H5HŨH9uH[]fUHSHH@;H5^H腨H9uH[]fUHSHH@;H5HEH9uH[]fUHSHH@;H5ޖHH9uH[]fUHSHH@;H5HŧH9uH[]fUHSHH@;H5^H腧H9uH[]fUHSHH@;H5HEH9uH[]ft@UiSHHHf;H5֕HHH9uH[]fDUHSHH@;H5H赦H9uH[]fUHSHH@;H5NHuH9uH[]fUHSHH@;H5H5H9uH[]fUHSHH@;H5ΔHH9uH[]fUHSHH@;H5H赥H9uH[]fUHSHH@;H5NHuH9uH[]fUHSHH@;H5H5H9uH[]ft7UFSHlHHfD;H5ƓHH9uH[]Ðff.@t8UFSHlHH;H5vH蝤H9uH[]Ðff.@UHSHH@;H5.HUH9uH[]fUHSHH@;H5HH9uH[]fUHSHH@;H5HգH9uH[]fUHSHH@;H5nH蕣H9uH[]fUHSHH@;H5.HUH9uH[]ft8UBSHlHH;H5H H9uH[]Ðff.@t@UjSHHHf;H5HHH9uH[]fDUHSHH@;H5NHuH9uH[]fUSHD$ Mt(t$hLL;H51HHH9uH[]ff.t8UFSHlHH;H5HݡH9uH[]Ðff.@ t1UFSHlHH;H5fH荡H9uH[]Ðff.@HH9AWAVIAULATUSHMLML@}H5HL9u;H5ΏHI9uILL9uH[]A\A]A^A_ff.fHATAUSu[]A\HH1H5T[ WE~=IcH\HlAD$L%` H)fDL1HH9u[ ]A\釚f.DATAdH UHSHpdH%(HD$h1IL脐L|H5B HH躊HLAdPAH C 1;LL0H5^\ HHnHD$hdH+%(u Hp[]A\@AUAH % dATIL-&\ USHxdH%(HD$h1HH軏H賗H5LHALdAH1EiMiMbI&qHiH5[ LH觉Dúd1EiLHMiMbI&*H"H5q[ LH`HD$hdH+%(u Hx[]A\A]0AUL-9 IdATLIUSHHxdH%(HD$h1HH讎H視H5LHILdI H1vHnH5Z LH謈ILdIH1A;H3H5dn LHqHsZ H= HDHHD$hdH+%(uHxLH5Fn []A\A]+fDAUL-WZ AdATLUHSHXdH%(H$H1IL艍L聕H5nHH过ALdAL1QLIH5m HH臇@LHY LY LDH A 1LHH5m H:H=j tvQH= HV HD返H5pm HHH$HdH+%(u-HX[]A\A]@tH=K H HD訒H=? ff.@AUL-X AdATLUHSHxdH%(HD$h1ILLH5HHEALdAL1׋LϓH5l HH L; t#<wxL t<Le H LDdLH X 1nLfH5l HH褅HD$hdH+%(u*Hx[]A\A]f<L~ H LDUDAWAdL= AVL5' AULL-[ ATUHSHxdH%(HD$h1IL轊L赒H5 HHLIE葒H5*l HHτALdAL1E]LUH5l HH蓄ALdA L1A!LH5l HHWH H= HDH5Vk HH+ALdAL1A蹉L豑H5yV HHLIE萑H5?V HH΃LIEoHHD$hdH+%(uHxHH5U []A\A]A^A_鏃zf.AVAAAUL-K ATLUHպdSHpdH%(HD$h1ILLH5ZHH ALdA L1A讈L覐HH5j HH=s t'<H=% t<H=5| H" HDTH5DU HH蒂u H= EuH=U %H5*U HHcdD1LLLH5U HH.HD$hdH+%(u'Hp[]A\A]A^Ð<H={ H HDNfAUL-Ȏ AdATLUHSHxdH%(HD$h1IL_LWH5HH蕁ALdAL1'LH5i HH]H,T H=)T HDHH5T H.H=^ tvMH=z HJ HD賎HHD$hdH+%(u;HxHH5*i []A\A]׀tH=Cz H HD蠌H=7 ATAdH p UHSHpdH%(HD$h1ILL H5HHJ؁%Hx职H5h HHH{fHHD$hdH+%(uHpHH5h []A\׋AUL- AdATLUHSHxdH%(HD$h1ILOLGH5mHHˋH5fDL  fHAH M 1HH薇H5 LHyLH5M Ly{ H5M LHy{H5M LHy{ օH5M LHty{輅H5M LHZy{袅H5M LH@y{舅H5M LH&y{nH5M LH yLLLxL聍H5ͯ H1w 1LYH$dH+%(u^HĘ[]A\A]A^A_@L i @L t@L d@L TL HCAWAVAUATUSHHIHD$规H5[ LHIxEL= HL5L L-L HD@H$D軌H;H@HLHHw{蕁LHHw{~LHHw{faH5L HHow{̃CH5L HHQw{(H5K HH6wH{}H50 HHw{cH5K HHw{؀H5GHHv{轀H5K HHvH{H5S HHv{臀H5uK HHvHL蚆H;$H\$HH5J H18u 讅HH[]A\A]A^A_ȇAWAVAUAATUHSHxdH%(HD$h1IHD$8t}DeH$I0H5J LHu}H5w LHuDH5J LHu} pH5zJ LH~uEJLH5_J LHcHi*H")D9DNFuEAD$H]H@L-(J Ld0HLd$L5IL= ۉ;HH~LHHt{~LHHtH{LHHtH{LHHtH<$H蝄H;\$uH|$8H5N H1As 跃HD$hdH+%(wH|$8Hx[]A\A]A^A_黅C@H$H|$8IH5I D9DNtEtAD$LmPHH= HHl$`HD$HHD$HH HD$ HHD$(H< HD$0HD$@HD$f.kA}MI[}Ht$LHksA}A}Ht$ LHQsI}Ht$0LH8sLt$ELHپH1IIxI9uH|$I@言Ht$(LHrH<$LL;l$AF~AWAVAUATIUSH8H|$!HD$ wHD$(Mt L5ILt$(LH5[ LkrH\$H;~H5fG LHLr{~H5RG LH1rf{ZD$fHcHl$IŋE}HHD$C D$5~H5|O LHq}~H5F LHqH}~H5F LHq}wEH f HcH>H=7 fH5* LHYq}IċEt=1L5 F | HI{}LLHqLL"9]wLH5&F LpH|$ L\$\$HD$D$L$@9H\$(HT$ H5E HpH߾6H5 H1po H8H[]A\A]A^A_H= H= H=ݨ H=ը H=Ө @AVAUATUSHpL-udH%(HD$h1Mw|IuIAdH D LD@1`uLLLoH="uHD$hdH+%(Hp[]A\A]A^H= }LHijH= |LHISH= |LH)7@IL胃H5ϥ H1m 3~L[2zAWAVAUATUHSH脃IHD${}Iĸ8FD]xH5X LHkn}BxH5X LHPnAUH]HL-C H)L=C L5C HD H$ZD3R{C wH5 HHmHLH}H;$;薂;HŃwHLHm;<t@@awLHHsm{JwLHH\m{3wH5B HHAmH{yH5B HH&mC { byH5B HHmCH{;yH5B HHlC{vH5B HHlC{}vH5B HHlfDH\$LH5A HilH߾H58 H1&k {HH[]A\A]A^A_}fDAWL=Ц AVAUL-- ATUHSHHdH%(H$1Ld$ ^xH$赀IMxHD$裀LdLH . HD$1PqLHyH5$ HHkC LIE&yH5/W HHdkCLIEyH5V HHBkCLIExH5V HH kCLIExH59V HHjCLIExH5U HHjCLAIEvxH5?U HHjKELL @ d1Ƀ AL3pL+xH5$U HHijKELL }@ d1 ALoLwHH5U H!jCH=o %tH=n <@t ALALMnLEvH5> HHhDCL1H > dEi nLvH5> HHBhLl$H5R HL+hCH٢ IEHuL|$H5H HLgLLxCH= IEuH5Q HHgHxtH5Q HHgH$dH+%(uHĘ[]A\A]A^A_ts@AWAVAUIATUHSHC|HHD$sI}IH9HFsH5> HH1gHtA1L5> {A|]HIYsLLHfLLwH9uH\$LH5= HfH߾W{H5 H1e vHH[]A\A]A^A_!xAWAVAUIATUHSHS{HHD$rH}IrH50= HHHfMtG1L5)= f. {|]HIjrLLH fLLvI9uH\$LH5< HeH߾hzH5 H1d uHH[]A\A]A^A_2wfAWAVAUATUSHHH|$dH%(HD$x1Nz;IqH5UQ LHRe{qH5G< LH7eC<<H=6 LHB^}jH5(6 LH(^}ojH56 LH ^} UjH55 LH]H}:jH55 LH]} jH55 LH]f}t>1Dr|@HIiLLH]LLmE9H|$L|mED$HŋD$;D$H\$HT$H5T5 H9]H߾qH5 H1[ llH(H[]A\A]A^A_nfDAWAVAUATUHSHqINi}IIiH54 LH\fEtIAEH]LtL-4 kq;HHhLHHn\HLslL9uLLH5q4 L\LpH5 H1 [ kHL[]A\A]A^A_mfAWAVAUATUHSHpHHD$Yh}IIhH5 HH[E AEH]@HL=+t L53 HL-K/ H$HLH@kH;$Bp;HgLHHI[{gLHH2[{ygLHH{bgH573 HH[{ HgH5/ HHZ;]{$gH53 HHZC8H{fH5k HHZH\$LH5} HyZH߾nH5H H16Y iHH[]A\A]A^A_kfDAWAVAUATUHSHnIHD$f}IHJfH5/2 LHYÅH]L=- HL52 L-2 HD0H$@n;H HeLHHY{eLHHwY{eLHHaYH{eH51 HHFYHLKiH;$uH\$LH5|1 HYH߾mH5 H1W QhHH[]A\A]A^A_kjff.AWAVAUATUSHHxdH%(HD$h1mIeH$eLc0Lk8HD$@{TbH50 LHbX{9bH5iLHGX{bH50 LH,X{RbH50 LHXH,$LH5R E1L=B. L-w HWL4$IlBHaLHHWBaH5 HHWBIjaLHH|WHLgCD9}HL4$HphH\$HH)HH5L'WLkH5 H1U ZfLhHD$hdH+%(Hx[]A\A]A^A_H;cH5LHVH{bH5ފLHVH{bH5 LHxV{O`H5. LH]V{4`H5. LHBV{`H5LH'V{_H5.LH V{_H5e. LHU{_H5BLHU{_H5+LHU{_H5. LHU{ w_H5: LHU{!\_H5- LHjU{"A_H5- LHOU{$&_H5- LH4U{& _H5- LHU{(^H5- LHT{*^H5- LHT{,^H5l- LHT{.^H5X- LHTLL1H H HH@b11H5% IH cLH51 LhT{c?^H5, LHMT{d$^H5+ LH2TC0{JLcxH-p M]H5, LHS{LG`H5, LHS{P]H5, LHS{R]H5, LHS{\_H5;1 LHS{fl]H58+ LHzSHD$ D$0HHD$fIH\$H)D$ EHHH1IHXM9uLl$@H\$D$`fLl$)D$@L{h)D$PELHH1IIXM9uH|$|`H5 LHRH|$``H5 LHRf{@g\H5-+ LHuR{BL\H5+ LHZRCu;{F+\H5+ LH9R{H\H5* LHR{D[H5* LHQ]AWAVAUATUSHHfHKHHSPHLCXHC@LK`LShHL$xL[pHHD$pHT$`HCxHLD$hLL$PLLLT$XL\$@LLLD$ LL$(Ls LT$L{(L\$Lc0I HT$8Lk8I HL$0I HD$HHI H;H$HL$ZH5) HHP{ZH5) HHP{ZH5( HHP{ZH5) HHP{uZH5 HHP{ZZHH5) HhPL1L L5H]11LIH^LHH5Y) (PL1LH]11LIH^LHH53) OH|$xHt$pH H 1H~]11LIHL^LHH5( OH|$hHt$`1H H AH9]11LIH^LHH5+ eOH|$XHt$P1H H H\11LIH]LHH5( OH|$HHt$@1H H H\1L1IH}]LHH5Q( NH|$8Ht$01H H rHj\11LIH8]LHH5( NH|$(Ht$ 1H H -H%\11LIH\LHH5' QNH|$Ht$1H H H[11LIH\LHH5' NH|$H4$H H 1H[1L1IHj\LHH5' MHKbH5 H1L \HĈH[]A\A]A^A__fAWIAVAUATUSHdH%(H$10bIO8IW@HMOHIG(MWPM_XH$MG`MghHT$pIOxILL$xH$MIGpLT$`L\$hMMEoLD$PMLL$8LT$ Mw L\$(I_0HT$0Ld$XHD$@HL$HLD$IMIHL$Ld$H$\aA?IPVH5e LH^LA?2VH5$& LH@LA?VH5& LH LA?UH5& LHKA?UH5& LHKA?UH5% LHKA?ULH5% HKLH5n$ HKDL% [UH5 HHiKA?UI HH HH5j% EKAUH5`% HH)KATH5U HH KATH58 HHJH$L1H HX11LIHQYLH5# HJH$H1һH DHAH{Hs1H H HN11LIHOLHH5 @Hs H{(1H H HN11LIHZOLHH5 @H;UH5w H1u? OHH[]A\A] RfAWL=DAVAUATU1SHHHhHt$dH%(HD$X1UI U{IJH5% LH@@H;tLt$A1L LE1.@J߀^CAHHuH|$0H 1AW HDLKL H|$YEXZH<$MLLHP?LHt$LL7?LSH5v H1= jNLPHD$XdH+%(uHh[]A\A]A^A_Jff.AWAVAUATIUSHHhHt$dH%(HD$X1~SH$uSA<$I1Ht H(LHH<$Hl$0H5 [>wfAL H1  HDL|$E1LX L CLKHLH=Ht EtEuH$Ht$LH=HGRH5t H1< LHOHD$XdH+%(uHh[]A\A]A^A_[Iff.AWAVAUATIUSHHt$dH%(H$1 RIIAl$KM$pHD$I$M$(I$ L\$(HD$HAD$JI$(I$0HL$PM$xLT$ M$  AD$IH\$8HT$@H\$pH ID$LD$8HLL$ L AP1UBID$L$A(H$)L1)Lt$wL BID$@LAH$Lv 1 AAL$I$LL@ H$1LT$hAA<$XZEH5- LH;A|$rEH5 LH;H(IH5 LHf;LIH5 LHL;LHH5 LH2;A|$HEH5 LH;H-L?DH5s LH:A|$LDH5[ LH:A|$MDH5C LH:A|$NDH5LH:A|$PFH5 LH:A|$TFH5 LHf:A|$XFH5 LHJ:A|$\FH5 LH.:A|$`tFH5 LH:A|$dCH5 LH9A|$oCH5 LH9HI|$p;9HH-alGH5^ LH9A$|CH5D LH9A$\CH5* LHj9A$5@H5 LHC6A$?@H5k LH#6A$@?H5P LH6A$B?H54 LH5A$D?H5 LH5A$F?H5 LH5A$HAH5 LH5A$LAH5 LHe5A$P7?H5 LHE5A$R?H5 LH%5A$T>H5 LH5A$V>H5s LH4A$W>H5Y LH4A$XAH5A LH4A$\@H5, LH4A$`@H5 LHh4A$d:>H5 LHH4H|$0Ht$(1H H HA11HIHBLH5 L4A$=H5 LH3A$=H5 LH3A$=H5k LH3A$u=H5P LH3A$?H58 LHd3A$6=H5 LHD3A$ =H5 LH$3A$ H5 LH2A$H>H5 LH1H|$ Ht$1H H }Hu?11HIHC@LH5 L1A$0=H5 LH1A$4=H5w LHc1$LT$X0A$E1I$L= =H5? LH1A$b=H5' LH1A$:H5 LH0A$ :H5 LH0A$ :H5 LH0A$ r:LH5 H0Hl$LH5 Hi0Ll$EIfD3E;H(:H5 HH60{ :H5m HH0{9H5] HH/{@A$D9EHD$Ll$Ht I$ LоLCH5Pe H1>- =L?H$dH+%(u8H[]A\A]A^A_L;H5 LH.9ff.AVAdH : AUAL- ATUHSHdH%(H$1ILM3LE;H5 HH-Hw H=n HD;H5o HHT-EdL1AL2L:H5h HH-ٺdL1ALE2L:H5Y HH,e<HReservedD$xHD$pLt$pLD:H5z HH, Y<9HReservedD$xHD$pL9H5 HH3,ALd1 AL1L9HH5 H+H=f t!H=Γ tH=f HA% HEg9H5 HH+Hf H=,f HD;9H5 HHy+H$dH+%( H[]A\A]A^fHRound RoD$xbinHD$p@fo# )D$pfDfop# )D$pfos# )$fos# )$fDfo# Ƅ$H no effeH$ctf$)D$pfo" HnotificaƄ$H$DŽ$tion)D$pffo" A6AVAH %7 dAUL5 ATL%d UHSHpdH%(HD$h1IL/L7H5 HH)@H H=d HD~7H5K HH) LIE]7H5 HH)LIE<7H5- HHz)<!HReservedD$H$L6H5c HH,)Hd H=d HD6H5Z HH)H H=c HD6HHD$hdH+%(HpHH5 []A\A]A^(@fox! D$rrinHing occuHD$gfD$)$8fDfo! )fT$0)$fo ! )D$fo ! )D$ fo! D$leteHing compHD$D$)$3ff.ATAdH 4 UHSHpdH%(HD$h1ILt-Ll5H5HH'3H5i HH'<<foE edD$*H requestHD$ )$fo0 fT$()D$L4H5 HH'߁_3HHD$hdH+%(HpHH5 []A\&fo D$*HccessfulHD$ ly)$fo fD$()D$n@fo )$fo )D$Lffo D$ readD$$)$fo )D$@2AUL-(3 AdATLUHSHxdH%(HD$h1IL+L3H5wHH%ALdAL1+L|3H5 HH%H ` t%wYH 0' tH  H` HDHD$hdH+%(u@HxHH 1[H5 ]A\A]駜H  H}` HD$1@AUATIUSHHHt$dH%(HD$x1 xc w^H+ HcH>dhu:Hzf.HD$xdH+%(HĈ[]A\A]fDLl$AA1H J dL*L2H50 LHU$.lHHt H1HLH5 ,$IغdLH 1)L1H5< LH#/H|$L軷fDL踘LLXHl$Ad1H k0 H-)H%1H5ՑLHc#/H5 LHJ#DHl$Ad1H j H(H0H5 LH#>.fAUIATAU7LDHHHN7H5Y H1! 1H]A\A]!4AWAVAUATUSHHH|$dH%(H$1.HD$HH9LHl$ A7IHD$7I61Ia.H5 LH!DHHtZE &Do-HLH!HuH\$LH5 H H|$H0ILH;D$H|$L5H5W H1 /H$dH+%(uH|$Hĸ[]A\A]A^A_1Y,fAWAL AVIAUIATUSH8dH%(H$(1H\$HG8HPH1%L|$@IELA(H$)L1LD )%IEtH$0AL H$H1%A}XZ+H5 LH{A}+H5 LH`I}+H5 LHEA}+H5 LH)A}o+H5x LH I}T+H5) LHI}$Iu1H H 苶H,11H5hIHM-LH55 LI},*H5 LHA}4*H5 LHtA}6*H5 LHXH,H5 LH>L+H5 LH$H1+H5! LHAtK*H5 LHAv-*H5t LHIHD$HD$D$1LH+LLHtzD<+DPHt1EL$H LLl$`"D$sDPL 2LI21#mDHD$;H$(dH+%(uH8[]A\A]A^A_(fAWAVAUATUSHHXH|$1;HD$I(HH5' LHD$x(H|$HH5 ]HD$x(H|$HH5 ;HD$x~(H|$HH5 HD$x\(H|$HH5 HD$x :(H|$HH5 HD$x (H|$HH5 HD$x 'H|$HH5m HD$x 'H|$HH5O pHD$x'H|$HH5 NHD$x'H|$HH5 ,HD$xo'H|$HH5 HD$xM'H|$HH5J HD$x+'H|$HH5 HD$x 'H|$HH5 HD$x&H|$HH5 HD$x &H|$HH5d aHD$x"&H|$HH5K ?HD$xt[HD$(H\$H.HH5P 1 Y)H+H|$(HX[]A\A]A^A_&H\$DcJ<(HD$(IHtH@,&H|$HHD$0H59 KLt$HD$8fEu?Jf.Ht$ H|$0q)HD$HD$@HHD$H;D$8.{HD$ Iz%HH5 L{_%HH5 L{D%HH5* L{)%HH5 L{%HH5 L{$HH5LD L{ $HH5 Lv{ $HH5 L[{$HH5r L@{$HH5] L%HD$@ K SLk yL$LT$HHc&HD$@HL$L1T$HIL% tnfDE1t:LL1IDAHcEDH@SD9Ǹ IWfAC 9}ISfDH|$@%H|$HH5} BHD$HL$@HHD$@fHL$(HH,fH;Ht#HH9u???????????????@@ @@@@!@&@+@0@5@:@?@D@I@N@S@X@]@b@g@>AWAVAUATUSHHHH|$8@t$!HHD$0?HD$H1HF f.+*H|$HD$(#HHt H"HLt$(H5a LH|$%HHt"H5C LHg!H|$HD$!IHY@)LH$"HHt HW"HH<$HLHHt H0"HH<$H5$0 mLe)HHt H"HH<$H5 BLZHHt H!HL4$H5 I LH|$L$ |$ILHHHIHD$L|$ I@L0I(LH]HHt H=!HHHL%HHt H!HH5 HULHHt H HH5 H+L3HHt H HH5S HLHHt H HH5E HHL"LLD$IHD$L|$ H<$LH5 H|$LOIHLt$(HT$H5 LZH|$0L]"Ht$H|$8HD$HH\$0H&H5H H1 ^!HHH[]A\A]A^A_x#L8HH-@&HIxHHt HXHHLH#HHt H2HH5 LpHHHt HHH5 LFHNHHt HHH5 Q LLL!!HLHH2VDAWfI1AVAUEATMUHSHxt$ dH%(HD$h1&D$HD$`fD$HD$hashfT$)D$ )D$0)D$@)D$PH@BHHH|$(@e#1Ҿ&DLt$ŅmXL6>Mt$E~EL#E11AŅ1HcLLc|$ LfIHLHD9D$ u6D$$HD$hdH+%(HxL[]A\A]A^A_ÐH=I LE19H= E1H=A1E1H 0 H t!xH=) E1N@H=| E1>@H=] E1y-@H=Q E1aH=J KfDAWAVAUATUSHdH%(H$1HxI1IH!ŅHt$ i"AąI"L|$PH|$HcLAąLL$LLLL$LL$M #H$dH+%(HD[]A\A]A^A_D A8H=LH9 I1L1AH=iH hH=#vOS 8AILAH=I1H VH|$AAWAVAAUEATEUSH(D$hHl$`L$D$ dH%(HD$1&IH|$fDDDu?Ht|$ T$pHLHD$dH+%(uSH(L[]A\A]A^A_@S E1E1HT$H= D$HtoAH=˾1H v@SH`dH%(HD$XH^ H$Hh HD$Hl HD$H HD$H HD$ H HD$(H HD$0H HD$8H3 HD$@H5 HD$HftNDHH=HDDA9u;tWH 14DHT$XdH+%(uKH`[fH 1@H L1HAUAE1AT1AUE1SHHjjjTH Ht]DHHIHtPHtRI$@HHHE$HLHD[]A\A]HHD[]A\A]H &H= ff.HHdH%(HD$8t\fH1)$Ht$H)D$)D$ D$0D$HT$8dH+%(u`HH@GHH$Ht$D$HD$0HD$HD$ D$(D$,oD|ff.HHdH%(HD$8tTfH)$)D$ HT$1҉t$$H)D$D$0%HT$8dH+%(u\HHËGHH$HT$D$0D$HD$D$ t$$D$(D$,@HXdH%(HD$HtlfHH4)D$Ht$H)D$ D$@D$$HD$()$)D$0 HT$HdH+%(u~HXHHt$HHD$ H4HD$(1H$HD$D$@|$HD$0fD$8 fDrHXdH%(HD$HtdfH)D$0@t$6H)D$)D$ LD$D$@D$$L$(fT$4)$ HT$HdH+%(uHXËfT$4HHHD$ 1@t$6H$HD$LD$D$@|$L$(HD$,D$7fD$8 f.qHXdH%(HD$HttfH)D$0@t$6H)D$ )D$D$$ HL$D$@T$(D$,)$ HT$HdH+%(HXfH T$(1HD$ HD$,1@t$6fT$8HH$HD$HL$D$@|$fD$4D$7r@dAWAVAUATUS\$@/D$8D|$`Dt$h\$\$HDl$pD$\$\$PL$L$\$\$X\$H\$xH\$$@Ht$HL$Ht$xt$쉜$t$Xt$L$t$Pt$D$t$Ht$Dl$pt$@Dt$hD|$`D$8[]A\A]A^A_H$H\$L$@L$H\$x\$D$\$X\$Dl$p\$P\$Dt$h\$H\$D|$`\$@D$8[]A\A]A^A_X[]A\A]A^A_AWH5V 1AVAUATUSHHLo IMIUH HC H L@H1H5  I}11H yDz H{t( H{11H Jz H= ?HkLuMLAE1fH8HA9DBAGIHDHu1L=} @MFIDL1HCUHL4MuLQ DL1H v DLH M L9 1t H IUHH5; 1GH;tH[]A\A]A^A_fIE0HX(HtH= 'LCH L1H[(HuIUHH5 1[]A\A]A^A_H5 1aHHH1H5 AL= ff.AWAVIAUATUSHHL>Hj|$$Ht$dH%(H$81HB HD$HD$L H|$0H|$LMH1AWH Y^HD$HA?-u@IA?-tH5z L7Aą,H5m LAąRH]1E1HLt$(AfDH]HHtkL#LLHsHtLL\LLHuE1MuHIAH]Hu@DLt$(MtMIHMn(MMDMd$(MI4$L&uHt$|$$LHADHL$(Ht$Hڋ|$$SAH$8dH+%(|HHD[]A\A]A^A_DM1H 2HE1Mm(MImHHLHHfuHD$HT$HH;-HCufHHx-tHt$|$$L"A!f.IF |$$HD$(HD$HH_IFL-< H$0HHD$HDd$$IILt$,HD$H@HD$HD$L$HM\M4$LLm tIt$HtLW uHD$LHD$(LMtVH1AVH H]XZ11HLLaHD$HxCNfDMH A H1 IF IHHMFL  H5 1H- HL- HbHt IHHDH Ht1HLH5 1=fDDd$$-HD$MMH M H\$L1H*Ht$LLH|$$AUAL1AH5A HHL H5 1LL1AH5 mUH5 H&Ht ]@Ha ]ff.@AWMAVIAUIATIH5 UHHSHLL$\$PLL$Ht&MLL\$PHLH[]A\A]A^A_H5RGAWIAVAUATIH5/ UHHSH(Ll$`Lt$hHL$LD$\$pLL$%LL$LD$HHL$t*Lt$hLL\$pHLl$`H([]A\A]A^A_H5+Fff.AWIAVAUATIH5 UHHSH(Ll$`Lt$hHL$LD$\$pLL$uLL$LD$HHL$t*Lt$hLL\$pHLl$`H([]A\A]A^A_H5ELff.AVIAUAATAH5DfUHHHtHLDD]A\A]A^fDH]A\A]A^ff.@UH5$HHHtH]f.1]ff.UIHHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1HL$H|$LH$HD$HD$HD$0D$D$0HD$ xIH|$HtHHH5S H H|$HD$(dH+%(u%H]DHD$H= H!AUAdH  ATUHSHxdH%(HD$h1ILBL:H5fHHxtD H5 HHXǃ<H HcH>fDHD$hdH+%(HxHH56 1[]A\A]H=1 fL-0 H53 HHL%l LIElH5 HHLIEKH5 HHLIE*H5 HHhLIE H5 HHGLIEHHD$hdH+%(HxHH5s []A\A]H=/ @H=/ @H=/ @H=/ @H=/ @H=/ H= AWIAVAUATUSHXH<$T$dH%(H$H16 HD$ IHD$LLEOECD$HD$H=,H$L91MAILHH5S HHA>'HHt HEHH5 HA~H5 HHgA~H5 HHKA~H5 HH/A~uH5 HHI~ZH5 HHA~>H5\ HHA~"H5 HHA~H5 HHAFDA> D$wZAH c HcH>D\$H$;H5 HHV{H5i HH;H|$H;H $EfAGDd$;As7DHPH;T$s)H $AIL4AFAVD9D$ HT$H|$ H5P H|$ HH5( H1 H$HdH+%(s H|$ HX[]A\A]A^A_fDH|$ H51MDl$L,$LIHfLH5 HDT$H$L$AH dLJCDcD$(ED$01mLeH5թ HHDK)HHt H;HH5P HyDL$(L1AdH ! LH5 HH9D$0t$(DHHOf.\$H$;@H56 HH{%H5% HH{ H5 HHk\$H$;H5S HH{H5s HHd{H5e HHI{H5\ HH.{vH5 HH\$H$;IH5 HH{.H5 HH{H5 HHuD\$H$;H5 HH{H5 HHm{H5 HHSfD\$H$;H5 HH'H{nH5@"HH H{SH5 HH{ 8H5<"HH{!H5'"HH{"H5"HH{$H5y HH{(H5RHHk{,H5% HHQ@D$H $<H5 HH%Dd$1L$$.HfAJ߀^CֈHHuL$H21S2LEM $L _LAXRH5 HH1.fATJ߀^CֈHHuHL1SML$2Ly 2#YL^H5@ HHA|$\H5. HHA|$?H5" HHA|$"H5 HHA|$H5 HHA|$H5 HHI\$H$HC(HK0HS8L[@LSHLKPH$LCXHC`H$H$HKhHSpL$L[xDcHD$xL$LL$LL$LLL$`Lk LD$HH$I HT$hL\$pLT$XHLLH;HD$PHL\$(LT$0HL$8HT$@hH5] HHvDL% GH5 HHU{,H5e HH:{H5V HH{H5L[ HH{H5 HHH$L1H 胁H{11LIHILH5 HH$H$1H H 8H011LIHLH5 H\H$H$H H 1H11LIHLH5R HH$H$1H H 袀H11LIHhLH5 HH$Ht$x1H H ZHR11LIH LH5 H~H|$pHt$h1H H H 1L1IHLH5 H9H|$`Ht$X1H H H11LIHLH5~ HH|$PHt$H1H H H11LIHQLH5H HH|$@Ht$81H H FH>11LIH LH5 HjH|$0Ht$(H H 1H11LIHLH5 H%AdH5 HHGH5 HHL|$(HLIGnEt<E1L$H LLDtLHHII uLL|$(IދHH5Z HHQH5S HH4yH5L HH\H5D HHDAFEfH_.Dl$A)AD$IHi98H#HD$0H$J4(1J߀^C׈HHuH$H21SL L2H|$8MXZH|$(H5W HH?A#E1H$Lt$(EDd$0J\(L- D;AH$PH5 HH{5H5` HH{H5L HH{H5= HHH{LHHH{H5- HHlE9SLt$(!f\$H$H;H5 HH.H{uH5 HHfAWAVAUATUSHH8H|$IHD$(TD{;HD$D|$H57 LHDH5% LH{H5 LHy{H5 LH^EKD$Ll$HcLIƋ;vH5 LH{<$IVH5 LH{;H5 LHED$KIAEt}Lt$ E1MfDHcALIH;H5/ LHy{H5 LH_LLdD;<$uD$DLt$ ,LH5 L*H|$L-D$D$;D$H\$(HT$H5 HH߾tH5 H1 $H8H[]A\A]A^A_>fDL$H|$(1H51 KAWAdH - AVAUATIUSH8dH%(H$(1ILH=It%H=LIHLL LEI(LLHHh%xAhwfwHV HcH>@L$IA1H P @LLHl$p H5NLHHdMHH  1HH5LHH$(dH+%(J H8[]A\A]A^A_[L=OILLLHL$HLL5 ELdL17L/LHHqELdL1LH5` HH=(ILLH5iPHHLHD]kHHLH5PILHLD3[fD#L=MItLLLHL${HLEdLH ?1LLHHLLHLD$LHd1YHQLH5 HCPDsTI I Lt$IOLH5>LIZLL_H|$LFDCXDD$I L ?LLLILLDD$LHd1HL _?LLHDD$LHd1A`HXLH5 HDC\DD$I`LH5?LIkLLp|$L4FDC`DD$ILH5>LI)LL.|$LrGDCdDD$ILH56=LILLL5 DD$LHd1iHaLH5' HDKhDL$HD$gHT$H5g>LIpH|$Ls|$LCDDL$HD$HT$H5;>LI%H|$L(|$LGD$}HD$LO<HT$LLIH|$LDD$LHd1`HXL<LLHD$H H= HD'LH5 HeDDD$D$I"LH5g=LI-LL2t$|$LHD DD$~ILH5?=LILL|$LIDDD$9ILH5=LILL|$L5DHD$OL :HT$LLIUH|$LXELdH1HL :LLHELdA H1HAL LLHELdAH1eH]LH5 HIhL.:LLLIpLLuALdH1HL9LLH.ALdH1HL  LLHLzH5 H1 *H$dH+%(u5HĨL[]A\A]A^A_.fDH5 L1^mf.HCHHUSHH;HH5 HH!{H5vHH{H5c HH{H5 HH{H5\ HH{H5L HH{ rH5E HH{ WH5# HHe{H5sLHA tH5 LHff.fAWL=Ѻ AVAUATUSHHHt$*H;IH5i HH%{H5R HH {RH5= HH{8H5' HHֿ{ H5 HH輿{H5 HH袿{H5HH舿{H5HHn{H5HHT{ H5HH:{$H5HH {(hH5wHH{,NH5HH{0H5. HHѾ{2H5 HH趾{4E1H H5 HH葾LH5 HSH;AHILLHR{)H5 LH7LLIHHD$H5i HH蕻EI] HL= L5 ID@L- H$@;;H H,LHH>{LHH'{LHH{H5ε HH{H5˵ HHں{H5õ HH迺HLH;$JH\$LH5 H蓺H߾H5b H1P HH[]A\A]A^A_AWE1AVAUL- ATUSHH HH<$IHD${IH5+ LH{LH5 L5! HعH;AHHLHH誹H{LHH蓹HLH$@D9}H\$LH5ȴ HdH߾H53 H1! HH[]A\A]A^A_AWAVAUL- ATUHS1HIu}I9H5Y LH׸4D|]HI LLH謸LLEf9G9LLH5 |LH5K H19 HL[]A\A]A^A_fAWAVIAUATUS1HdH%(H$1HD$tIHHtbA,@tLl$AH N IǺL1HRLLH荷LLHuH\$LH5 HbHH51 H1 HH$dH+%(uHĨ[]A\A]A^A_AWAVE1AUEATUS1HH|$dH%(H$1H$HD$fHD$HcL,Au@DHl$01 HHAE<<<HD$Lt$ IL% oD)D$ @ELLH1IIûL9uAL5>IҿH5&LHA}趿H5y LHĵA}蚿H5b LH訵LPH5LH莵H6LLHxH<$H<$LqDH$HtH|$HH55H\$HH5 H1 cHH$dH+%(HĨ[]A\A]A^A_f<u@H=LKH5] LH色L<$d1H LEGL H5| LHKAGHg H= HD߿H5 LHAGH H= HD豿H5ԭ LHMGd1H L耷LxH5m LH趱MGd1H v LGL?H5: LH}Ll$ELHH1III9uH|$H5 LH*D$D$H$@9D$H$dH+%(uoH[]A\A]A^A_DH=b <@H=q,@H=q@H=ϱ H=c<{H HB{ff.AUAATIULDLHHHH5* H1 莿H]A\A]AWL=S AVAUATUSAAAAHAdH%(HD$x1Hl$AALAAIĺdAH1DL$ OHGH5 LH腯DLHd1HH5d LHPDL$ EELdH1شHмH5G LHELdH1褴H蜼H50 LHڮL]H5 H1藭 HD$xdH+%(uVHĈL[]A\A]A^A_@ELdH1HH5t LHL2fAWAVAUIATUSHxdH%(HD$h1A]HfDHH5X HHftL1IL=B DALdL1fI|HLHH蚭A9žHH5d H1R ȼHHD$hdH+%(u#Hx[]A\A]A^A_ÐHH5F[ 1/AWL=S AVAAUMATUSHT$Ld$L$ DD$dH%(H$1DLLHźd1dL\H5HH蚬ELLd1/L'H5HHeDD$L1dLLH5gHH.DD$ LLd1±L躹H5z HHDD$L1Ld茱1LHϳNH=DbH5֙ HH蠫H#H5o H1] ӺHH$dH+%(H[]A\A]A^A_fH=aAx誷L5H50HHIH-" AELL= HE蟸L LLHڪAELHEyLLH軪AELL5 HEHLL i LLH自H5HHImAE LHE LS LLHGAE LHELLH(AE LHEǷL LLH}H5 HHIAE@LHE臷LΦ LLH©AE@LHEaLLH裩AE@LHEBL _ LHL}A.AH=`AA}葵H5 HH/A}uH5ְ HHA}YH5 HHA} =H5 HHۨA} !H5 HH迨A}(H5 HH裨A},H5" HH臨A}0ʹH5 HHkfD|$覴H5߰ HHDA}H{H5Ϥ HHfpL{L$L5 ALdL1膭A|HLHH蹧I9u蚳f.AWAVAUATUSH(t$ T$ vMHE1HB@L= HD$L- +H{H菳LHH1H{xH52 HHH{]H5` HHCIcDL>fDH=f{H5HH蹦{H?, H=UHENH5%HH茦{ӲH5HHq{踲H5 HHV|$ t({H=[ H5F HH'HLA(H\$D9d$ H([]A\A]A^A_fH=@H=@H=@H=@H=j@H=T@H=U@t$ HߺHHD$QHT$H5i HM!AWAVAAUAATAUHSHxL=dH%(HD$h1Mt~HATEIAVH d1H莪HVDDHIHLHL贤H=4t2HD$hdH+%(uYHx[]A\A]A^A_cIuLH5G H15 諳Lӵ,ff.AWAVAUATUSHH $Ht$ IHHZHT$dH%(H$1hA>I輭H5 HHʣLH5 H踣A>FL|$E1Lt$ L$fkH|$HH苳DSH5 HHaDd1H z LLH5"HH(3|$ HHt H輰HH5Y H{ѬH52" HHߢ{A賬H5 HHHsLfA9ǹAFA,LDH5HH肢CH\HD$D9H$dH+%(uHĨ[]A\A]A^A_.ff.AWAH AVAAUATUպdSHxdH%(HD$h1ILD@1芧赶H=UIt%CH=DLIH计LL賱DKHHt H;HH5P[ LyAdH LH-(D@ 1t"aH-tH- HHDLɮHLH H=tAHD$hdH+%(uhHx[]A\A]A^A_fH-W HHDfLCH5 H1} Lt@AWAVAUATUSHdH%(H$1L|$ AAH AILdѥH=H膬H=LIHHLAw}H DHcH>fLl$ E1A1H  dLGrH=Ht}H=LIHkHLpH=tNH$dH+%(H[]A\A]A^A_DAwH DHcH>H苳H5 H1ŝ ;HcxfDM_LDHLH5 HH荞Hx̪H5 HHj謪H5 HHJAd1L$AH LãL軫H5ۛ HHAAA4HH5ț HҝH=+R At"H=AtEH=/ HHDNH5 HH茝߃ҩH5 HHp ߃豩H5 HHOH=H=1HDH5q HHMEEL$d1H  L蝢L蕪H5 HHӜI} H5 HH踜I}(H5 HH蝜I}0H5 HH肜H=tH= HP HDH5ޛ HHB胨H5D HH!iH5Z HHMAEHH=HD荩H5N HH˛f߃ H5 HH誛EH5HH舛ЧH5 HHn H\H=PHDH5'HH=H+H=HDΨH5 HH H H=HD蚨H5s HHؚ߃H5 HH輚WH58 HH蝚8M/A}IEfDHH HHI9u赦H5 HHSCML$IDEL- HD$LH)l MITDL=A<tL=A<tL= H@LDLI芧LHH̙L;l$aAELdLLL==LD1CAE<ttL=9H5 HH|HjH=^HD H5< HHKL-L%LIHڥH5S HH@LIE蹥H5 HH LIE蘥H5 HH֗LIEwH5` HH赗LIEVH5 HH蔗LIE5H5 HHsLIEH5s HHRLIEH56 HH1LIEӤH5d HHH H=4HD袤H5C HHMwRH5H1HIL$賖Hl$fD胫LHI襦AغdLH | 1'LH5Wm LH]IlL1H l dHAALڣH5۠ LHHHYH5 LHH EHl$Hڈ H= HDL5L%kH5 HH評LIEJH5[ HH舕LIE)H5 HHgMA} L$L5 薡HH5D H4EELLd1ɚLHH5G HEELLd1蔚L茢H5E HHʔA}H5Z HH诔JMAI]1H HHHHL9uHH|$HS㥛 HHHT$ƛ1IƐHHHHL9u腠L$H5Rl HHL@LH$HL裡H5 HHAEH H=.F HDuH5% HH賓AEH/G H= HDGH5 HH腓 ɟH52 HHgAL$1AL5 dLELߘLנH5 HHDL- LdLI1蜘L蔠HH5 HҒALdL1hL`H5 HH螒LdLI1-L%H5 HHcHQH=EHDH5E HH2H$ H=UHDßH5, HHMnLD$HL$Mf HT$I HD$ I חH5 HHuH|$ L1H #H 11HIHؙLH5_ H6H|$L1H "H˘11HIH虙LH5 HH|$Ht$1H H "H膘11HIHTLH5 H貊H|$(H赚HD$0ID9H\$8HT$(H5 HwH߾H5F H14 誙HHH[]A\A]A^A_ě@AWL=] AVAUATUSHHk0H8dH%(HD$(1Lt$֞HD$lIHHH$諞IHEH EuvH\$LH5 H觉H*H5q H1d ژHD$(dH+%(H|$H8[]A\A]A^A_ޚfD}oEH )D$LLH HL腈H轖H5aLHLLH;,$#̔ff.AWAVAUATIUSH(dH%(H$1H$xfL)D$H)D$ )D$0)D$@)D$P)D$`)D$p)$)$)$)$)$)$)$)$)$莓LLc裑LMIILD$LLLD$LHL}LU讑H5 HH輇H|$bH5 HH蠇HHH5 HH膇LHHt HHH55 H\LHHt HHH5 H2LHHt HʔHH5 HLPH5 HHLvH.H5k HH̆LH5\ HH貆D芐H5O HH蘆HH5b H1U ˕H$dH+%(uH(H[]A\A]A^A_ϗ*f.ATIUHLHґHHt H貓HHH5g HsH5 H1譄 #HH]A\D@AWAVAUATUSHHH|$xnHD$pHHD$`GHD$@H DHD$hڑH|$@HD$X+HHt HHH\$hH5pf H$H|$@誕HHt轒H5Rf HHH|$@豑HHID軙ISHD$ILHD$ 茒HHt H\HH5L蚄L†HHt H2HH5/ LpLȃIHLt$8L|$(f+H$HD$H踐LHD$PHHtΑHHH<$H5L谐HHt裑HHH<$H5XR ݃LōHHtxHHH<$H54 貃L芖HHtMHHH<$H5 臃LϊHHt"HHH<$H51 \L褕HHtHHH<$H5d 1L艉HHt̐HHH<$H5Q LΓHHt衐HHH<$H5]Q ۂLÐHH]HT He HD$HL HD${HIHLcHMIHD$0QHLUHHtHHH5 LCH{HHtޏHHH5P LH葈H5P LHL@H5s LHށHfHHt$LH辁H|$0Ht$LH褁D|HLH莁H|$HL葑HLHHHT$HH<$H53m UL}HHL5F Hb  HIHHtÎHHLLH誀HHt蝎HHHL܀H|$PLߐHLDHHuH$HT$PH5b H褀H|$H觐H|$(LJIH.Lt$8L|$(HT$H5N L`LHHrHف HN H$Hҁ L-؁ HD$HI耋HD$蔉HcT$HHHT$(HD$ɏHT$(HHHT$(ÔHHtvHHH5 LHHHtLHHHLH\H5 N LHjH|$(谋H5 LHNHֈH莋H4$LH/H|$uHt$LH|$LLH~H|$ LHLfHHHT$ H5j L~H|$XLɎH|$@L|IHH\$hHT$XH5` H~H|$`H芎Ht$@H|$xˇHD$@HH\$pHT$`H5 HD~H߾ǒH5 H1} wHĈH[]A\A]A^A_鎏ff.AWAVAUATUSHHXH|$HQHHD$8蔅HD$(H葒H|$(HD$@肋HHt HBHH\$@H5^ H{}H|$(HHtH5^ HHR}͉H|$(HD$0HD$H H|$HD$ HHt H輊HH|$ H5> |H|$HHt H莊HH|$ H5|H|$HHt H`HH|$ H5] |H|${HHt H2HH\$ H5bHk|H|$0HnوH|$H$}IHlD$H] LIHD$蛂LH5J H|}LIIH fDLX|I谐LH腇HHt HeHH5 H{LHHt H;HH5\ Hy{LсHHt HHH5I HO{LWHHt HHH5)H%{LzHHt H轈HHHzHLLL|IHLL|$H5=\ LzH<$LʊH|$LD$(IHlD$H$H|$ H5Yf {zHt$H|$(v 1)HHt H虁HHH5C sH=SIs8yuHHt HTHH5 HsH=y'@HH5O H1=r 賂HۄfDK~H!H@AUHHATUSHdH%(HD$x1H|$HD$OLD$MLl$H t d1LYx脇H=$xHt%H=xHLI}rHL肂*AAǃtwH= HH5NJH1rD |HH5ϊHrH=w H|$~HD$xdH+%(2HĈ[]A\A]DDHHt HpHH5_w HqH=s RZD1D辀HHt H.HH5w HlqH=HD$LzT z{p8qlsHHt H~HH5y H qH=vHHH5ȧ 1o /HWf{|LS Hrff.ATHIUSH H-udH%(HD$1HH|$LHD$豄xmH|$HH HE HEI}HLHpH=ut[H|$|HD$dH+%(u{H []A\HD$H=R fDHT$莄HL$HEH#HH5l 1]n ~HkQ{H=R &H1fATIUHdH%(HD$1H$HMn8FqHLIH1J}xvH<$Htu|HH55 HnHIHH5 1m }H!H<$x{HD$dH+%(uH]A\H$H=Q |EzHCfHtff.@PXH G H5Qp H=gp Htff.ATfIUHH8dH%(HD$(1)$)D$ HH tA<1 uHcI1 Ll LqsHtiH={ B{H1DP HHHH9u$H5{ 1hH1@PHHHH9u$H5{ 1h$1$H5{ D$D$hH1P.HHHH9u$H5{ 1QhH1@P:HHHH9u$H5{ 1hH1@JFHHHH9uHfH*Y $H5{ ZgH1PRHHHH9u$H5{ 1gH1@P^HHHH9u$H5{ 1Qg$1$D$H5{ &gH1ɐPvHHHH9u$H5{ 1fH1@HHHH9u$H5{ 1f1@HHHH9u$H5{ 1~f1@AHIHL9u$H5{ 1EfT$H$H$1HP HHHH9u$#H5{ 1eH$1PHHHH9u$/H5{ 1e$?1$;H5{ D$AD$=e$K1$GH5{ D$MD$IOe$W1$SH5{ D$YD$UeH$1@PFHHHH9u$_H5| 1dH$1PRHHHH9u$kH5| 1dH$1P^HHHH9u$wH5| 1qdH$1PjHHHH9u$H5| 19dH$1PvHHHH9u$H5| 1dH$1HHHH9u$H5| 1cH$1HHHH9u$H5| 1cH$1HHHH9u$H5{ 1NcH$1HHHH9u$H5{ 1cH$1HHHH9u$H5{ 1bH$1HHHH9u$H5{ 1bH$1HHHH9u$H5{ 1Nb$1$H5{ D$D$b$1$H5| D$D$a1fHHHH9u$H5| 1E1a=fL$;H5fHwI9uD$Hl$0Et;uH}iH}sHQo@1Hl$0Euŋ}}wHD$0LwHD$Mt LoIH|$LH5d L5 avIv$IkLLHaIHL$zH1P HHHH9uHL$ H- LD$nkLHHaLH5DH5Z HHL:ÀLIEGH5n[ HH+:@LIEGH5[ HH : LIEGH5Z HH9LIEGH5SZ HH9LIEfGH5Z HH9dALL1:?L2GH5 HHp9HD$hdH+%(uHx[]A\A]A^A_Hl$EtluH}7H}UBH >gxHM3AąxFDd$HD$e}FfDE1eaH=aE1a9LH=4Hi1AZH oV B9H=4Ai1H EV HfiBH=#V S a {7HVff.@AUIATIUSH9@H5 R LHHD+He H=T HD8HH5CH+HLH[H5Q ]A\A]*ff.fUSHhooOdH%(HD$X1oW o_0Hog@D$P)$)L$)T$ )\$0)d$@HtQHH-HHCa HGH'8H5LQ HHe*HD$XdH+%(uA1H o H Gn ff.@ATAHUDSH`dH%(H$X1H$L$D$HH';H|$Ƅ$bH$HD$H HP H$HH$bAąHD$xH\$PHT$HHD$0HhHD$81HD$HD$H\$ D$(@|$,HD$@fD$HAą|$H$@;H5H!H9uHl$EtauH}H}H]H$XdH+%(MH`D[]A\~AHl$Eu}c!묐H=!O H=5O HT$PH5LO 1 HT$XH5\O 1 HT$`H5lO 1 HT$hH5|O 1 HT$pH5O 1p H$H5O 1U H$H5O 1: H$H5O 1 H=SA1H l H5D@AWA$HAVDAUATUSHdH%(H$H$pH$pIHD$81HH H|$0Ƅ$xnH$pHi<H O H$HD$8H$H7H$H7H$HD$DHl$0EtnuH}H}oH'H$dH+%( HĨD[]A\A]A^A_;H5 HH9ufD} fDEHD$Ld$HD$Ld$0D$ 0PfLd$@D$HT$$HD$(HD$0D$8 fT$H=? Ll$AE+A}4DH5)? 1A?f.).@D1H5? H=9 L=rZ 1L52LA0Lc HD$fHt$$H D$HHD$,Ht$4fL$ Zf.ATAfHUH > DHdH%(H$1H|$LD$@HD$HDŽ$)D$@)D$P)D$`)D$pMHl$AąuvUHD$HD$HD$D$ 0#ED$$H|$HD$(HD$0D$8fD$ HPDXLQ@tHHH`HDž`HhDžp0HxHDžDžƅAąEJLPMtAEt^tALHEdH+%(HeD[A\A]A^A_]@D$fDI}GI}@A}DDHL  IPPPPPP1)H0P H@HHHH HHEL L1H~6 H5} Lz H y 1HH5] }HHE1HfCCHIIHHH;HuL- ɿ1HLHHE1fFFHDIIHHH;HuHL1LHL H5q5 DfAFEEAVHZPHI PAFPHC P12H E1AfAFAFHؐIIHHH;HuHH5 1HHE1fFFHIIHHH;HuHL1]HHHfGG1D2HHHHH;HuHfH*ɿ^N HH5 ZHH E1 fFFHIIHHH;HuHH5 1aHHE1fGGHIIHHH;HuL +v 1HZH5U HH%#)HWfG+G12HHHH;HuLHHL  PHH5 1EuX1E1Z/A5fAG7AGHfDIIHHH;HuHL1 HH=E1;AfFCFH@IIHHH;HuHYL1HHIE1GMfGOGH@IIHHH;HuL5 1L HL/HHUE1SYfF[FHfDIIHHH;HuLr L1HHHaE1_efGgGHDIIHHH;HuH& L1UHHmE1kqfFsFH@IIHHH;HuH L1HH}L= L5/ DyL fFwDEɈVH~ PFLAWPH P1HHH DL` fFDEɈVHGPFLAWPH$ P1HHH DL fFDEɈVH PFAWILPH P1H E1AfAGAGHfIIHHH;HuHL1MHHE1fGGH@IIHHH;HuHOL1HHE1fFFIIHHH;HuH L1}H@HHuLPffHIfD;H56 aHL9u)HƒfHH H*XfHH5 HL\DLH51ƅLH1H HHHI9uH5, 1y1CHHHI9uH5, 1IH5, 1/H5 - 1H5(- 1H5N- 1t60LH5u !fD8uPHH uH53- 1H5Q- 1mH5o- 1SH5}- 19H5- 1H5- 1%=d%=N %=,%=8%=$D%=P%=.\%=h%=8t%=2.13IIM'H,mLkE1HAqfAGsAGH@IIHHI9uL-S. ɿ1H`Lra_E1AefAGgAGHDIIHHI9uHL1DL H5- EEfAGAWHPH PAGPH P1H E1AfAGAGH@IIHHI9uIH 1LE%#E1A)fAG+AGIIHHI9uIH1LLLLPH= A1H @ H2w# H55* 1q}zyH5 HH {HH |HH }H H ~H(H 1 nmH5+ HH oHH pHH qH H rH(H 1cbaH5 HH cHH dHH eH H fH(H 1BVUH5* HH WHH XHH YH H ZH(H 1mJIH5* HH KHH LHH MH H NH(H 1x>=H5q) HH ?HH @HH AH H BH(H 1w2H5( 1C&%H5~( HH 'HH (HH )H H *H(H 1H5e' 1qH5{' 1WH5' 1=H5' 1#EH=W A1H H= H9H@LPHVHLLPH1@ATAHUDH(dH%(H$1H H$D$HD$(1L$HHHH|$D$H$H H V( H$HD$(H$H_ HD$D$ D$0Ƅ$pDŽ$DŽ$H$n0AątOHl$HtEbAHH$dH+%(H(D]A\@H|$(HL$HT$1DVD$T$f HT$ D$HHT$@HT$D$0 D$P8D$XD$h"RD$`D$ H|$@T$TD$vAąEuZT$ DD$0H , t$H ] tH 1 H3_ HEH5' 1kfDDRDH}H}}JH5& 1ALH=, HT$(H5& 1H= Ap1H 9 H.D$0H5ff.@UHAWAVAUATSHH $HHfH  dH%(HE1AHHLpDHDžHDž)p)))-AƅtUHHHtdDHHEdH+%(HeD[A\A]A^A_]fDH5 H= IHtHH= H= XMtL^H=o% zH=% .MtL_H=& PH=Y& MtL^H=% &H=o% HDExHE1HDžHHHHHHHDžDž@HHDžfD AL-& fDHDžhH@HHLuL,,HLS sHC{KDKDCMt1RLVPH P1WLQH S HCH0{HKDKLRSRHPH P1WDC7H H0L9s u ;CDKf%H LIHS㥛 LLHHHHH9HLLt$ pHHHiI)ѺAQDl,PAPAPA PA,P1xH0HxH1ɾHHDžHHH HHDžDž@H(HDž0f8AƅML~qH{H{{H= A1H 3 Hn H=[ A1H 3 H= =HUHAWAVAUATSHH $H(svE1dH%(HEHlog_c1.cAf-HH8svƅ/f"DL0ƅ$HDžƅH%Hlog_c2.cHLHHi Hƅ8wH0HH F" HPH" H`'L A$!A|$HE1HDžHHHHDžDž@DžHHDžfD-uSHH5CIHtH,H=! BH=! LMtA$mDLHEdH+%(+He[A\A]A^A_]@H%H5IHtH+H= H= PMHѾLHH1H޿1MHѾLHH1aH޿1tsMtL*H=! H=! MLxI|$I|$A|$uMtL3H=E hH=q MtL*H= >H= MtL3H= H= AusAusƅLfDLfDLƅt2@HMMAWLJ :_AX tAuHAmsMMAWLfDƅj:AYAZmsmsƅffƅH؍sAWMMىL牅:XZ uĻ tH%ff.@UAHAWAVH8L0AUIATSHdH%(HE1ƅHDžHHHJHH0HHDHPH ƅ8bH`T!HAIHD@1HHE~E1HHDžHHHHDžHDž@ HHDž fD(AąFHDuH5LD1D LH5 1~ L l Le 1H Uv H H5FEAEH=e Hp1LMtAtPt3LHEdH+%(uHeD[A\A]A^A_]fDIWI@ADHEIƐ;H5v HL9uh8IUH1H5.7~.fHLL=Ct_HDCLH HL11Ҁ{HCtSHHHHH9uH5 1H L9uf.fDKH51DCQH HHL-, L54L= U@<PC LDKP-PE1XZH H;CtHDCLIL1CfDH= A1H ! H*Hff.@ATAfUSHHHJHDdH%(H$1H|$LD$@HDŽ$HD$)D$@)D$P)D$`)D$pHl$Aąu|UD$BUHD$H|$HD$HD$D$ 0T$$HD$(HD$0D$8fD$rAąu{H=oHl$EtSuH}H}HDxH腾AąxuDd$+@}XfDH  H=]A YH=)A~:H=m)H= A1H  HH= F"Jf.AVA6fAUHDATUSHFH0dH%(H$(1H|$pHl$)D$HD$ LD$pHH D$xnH|$HD$pHH H$H$HD$H$H]H$HH$HD$ H$ HCH$0Ho H$HHD$!H$HH$hHODŽ$H$DŽ$H$Ƅ$pDŽ$DŽ$Ƅ$eƄ$PsH$xHH$HNc H$HD$H$H Ƅ$tDŽ$DŽ$H$+Aąt4H$(dH+%(H0D[]A\A]A^f.H|$H$ H>Aƅ]=L$Ll$u=AUA}HELl$Aąy$8D$Ic1H$ CHH9uAEfHD$`)D$0)D$@HL$8D$@8)D$P\AED$DD$H|$0T$D$`D$LDD$f ЉD$PD$ D$TD$!D$dAąuBH=lHl$Et:uH}蔾H}+HjfD}fDH ܻ H=AH=ANkfH H= A:'苹HH=a Hm1 4HH=8 A1H y HhwH=W AWAVAUATUSHH $HfH dH%(H$1AHH|$@L$DHDŽ$)$)$)$)$ D$ t2H$dH+%( D$ Hĸ[]A\A]A^A_DH|$@H$H߉D$A:H6 Hl$HHHH$4HHD$1HHD$@ED(ExfLd$PHGRITINNOHDŽ$)$)D$PDŽ$D$PH$)D$`)D$pHsvgi1LHl$hHD$THHD$t1HHHD$@DExALHHD$pHHD$PHD$XHl$`D$h@|$lHD$xHDŽ$fD$XHt$H$D$HH|$ H IFDN RVD@1RVRH MIH$HHD$8H | H1謹HHHHD$0IED$D$,H$$D$(HD$ 1HArtHfDML H@E1HcdumpstaHEEfDDD$ElxHGRITINNOfID$@A)$A)D$A)D$ A)D$0D$PDŽ$H$Hsvgi1LHl$hHD$THHD$tBLH1H5AA@1lE9;1H|$HHD$@8xLHHD$PHD$pHf$HD$XHl$`D$h@|$lHD$xHDŽ$µ D$ D EgxfLd$PHDŽ$)D$P)$D$PDŽ$)D$`)D$pI{xID$@fA)$A)D$A)D$ A)D$0D$PDŽ$M@1۹HHؾHLHHcdumpendHEEHT$H5t1ݯD$(D$(;D$,HعH|$HHD$@L$xID$@fA)$A)D$A)D$ A)D$0D$PDŽ$Hsvgi1LHl$hHD$THHD$t¼DH$H$1H$]\[Z $D$,uH=fHL$H$fH$$ID$H$H$HHDŽ$AH|$ DI RD@1jRQRQH  R-H0MIH$HHD$8H ȗ H1HCHHHD$0AIED$OxLHHD$PHD$pHHD$xHD$XHl$`D$h@|$lHDŽ$f$tLl$ fH\$HDŽ$$H$HH  IEEuI DK H$CRT$8D@1RRSRSRH|$HѳH0LHt$0H|$8Ll$ T$(I;T$,9 FHl$@EuH}XH}H觺MlL膸_xHGRITINNOfID$@A)$A)D$A)D$ A)D$0D$PDŽ$H$H=d AF1H e HF蔿}RNH=& AB1H ' HVWH= A<1H  H%fD$ \H= A1H  HH= A1H  Hh趾kH=e  3H=M cH=0 YYH= _$AWAVAUATUSHH $H$E1H- dH%(H$1AH$HH5pL$fDT$D$HHD$H$HL$H$HH|$H$H% H5H$HD$H$H  H$DH$0HH$Ƅ$wƄ$bƄ$jH$@cAą1HD$\$DE xLt$ E1HL|$fD;H5 H赾H9uHl$EtTt7HwH$dH+%(4 HĸD[]A\A]A^A_H}߯H}v@}xfDl$HvHו H5A 2@HD1ާ Y 1I H5: 轧DH5 -׽uH5 2輽L 1LoH l HeH5`]DH5Q -wuH5; a f0f=nft ǭ  H51ffDHD$fD$00HD$ HD$`HD$(HD$)D$`8)D$pu @D$4D$LHD$8D$@D$DD$H ft$L蜭Å|$fot$`!fo|$p)5 )= Dfo$|$H$fo$fo$)- fo$H $)5ۿ  )=޿ )-  Dl$D Dff=fS ^ U H5c1肥f Hl$EAH9 HkLD;H5F HmH9ufo|$p)5c )=l f= AH- HHD$胲DH1HIAzz-z ,$Hffɉڃ?*JX$J*Yf*X,ЁDffD?*OAX$AOA*Yf*XD,DLDLHAEAH9EAvyfD DLAH\$HQH5 H1苣H3fD 3 * H5c1WfK1IDLL- HHxfELAHHJ H ufELA HHH?ufDELAHHH^uD ˪ EtA H^D EtA H_dD EtA H`;L辷H5 H1L蠴kf=b bշIH$iIH5LHI̢vHL5 1cLH57H-f H蚢LLH5Q舢M~@AAADLLHHHu֋ ALD 5 H$H5,HHHH= ZH5HH%fDH  AH=Y@1fDߺ W uDߺ ,?u߻fߺ^uߋ U t^ 6 t_  K` -Df=" u~1@L5 M~AA<ٺHpHuߋ=չ He H51.f ۥ ҥ H5 1zf.f=j w5 1E14$eDffɉ?*HX$H*DYf*XD,DVt&DAAXDA-DDH= L5d 1LH5H- H LLH5M~f.AAADLLHHl Hu֋ {L5 M~AA<ٺHpHuߋ=շ H= A%1H H~̰4H=!x'AWAVAUATUSHH $HH $HH $HHdH%(H$31AI转?H5H$H1fHHL$DH H$H$HHeH$HL$HHT$@H$H5pH|$8H$L$H$H$HL$LH$(HaH$@H5: H$PH$H)D$@H$`H H$DH$LD$@HD$HƄ$lDŽ$DŽ$Ƅ$rDŽ$DŽ$ Ƅ$HmDŽ$XDŽ$hH$pƄ$nDŽ$DŽ$)D$PH$HWH$HH$HD$PH$HqH$H+H$HD$XH$8HvƄ$oDŽ$DŽ$Ƅ$ vH$HKs\$DAD$HT$LH|$PHE1E1AH ؅H кfA1~AAąxHD$8Dd$@[DH1fH\$`)D$`L$LMDd$dHDHH)D$p)$)$HDŽ$D$`D$H$Ll$x AąHLHEOUD$Df}DL$LD$ Ey $D$ HcD$HH$T$$1҅Dd$(HIHl$T$ Hk\HTLIHT$PHT$$9T$  T$ DD$ AA E\HD$E1HXLIHEh|$ tAAA HD$8T$@0DH1LMHfDHHE@H)E)E)E )E0T$dD$`D$H$Ll$x LLD8H?|$XDHD$8fo wfn$DŽ$DŽ$f8;f~$HfrMDHf~v AH D9d$ D$D{ tڋfnCfo DŽ$fA~$HD$8f8;frf~$8HMDDH vHl$A@EDDH萤Hl$8EtTt7HwH$3dH+%(RH3D[]A\A]A^A_H}ߝH}v@}xfDHAHD$88y@H$D$tH|$`HHT$hHD$`D$p0HD$xHDŽ$DŽ$Ƅ$脖H$AH$EtHH9t8 tL uLL$H1RH LA\$TD$XLLd$`T$\Y^LH LD띐HD$8Ll$xD8EDx$$H5D$D$1裔LDMDDHfo 7fn$D$`ffo -f~$f~f8;f~$fo f8;f~$WpHT$PH51kfHD$@$HH$HD$8HHD$MDH0iH=vfDH=A^fHl$AH$$H5$P$P$P$P$P$P$ P$P$P$P$P$ P$$PD$(1D$$Hpf}xt(D$ HcD$HD$$D|$XuKLDٕHxcE D$$D$ HcD$HTHLIŋD$HD$ HD$\aE HMH57PDM1DEAZA[H=UA进;E LDD$ CHOD$ D$ D$$HcD$HHl$Dd$(rH=%AvH= gtH=T$,MT$,AH=0fn$H=DL$, DL$,1 H=H=uAATAHUDSH`dH%(H$X1H=H$D$HD$1L$HHw H|$Ƅ$wH$HD$H BH$HH$HSM H$H: H$HD$H$HƄ$tDŽ$DŽ$H$AąHD$0>xHl$ 1ɾ|$StL Hó LD c@Bw Wv ?fH*LH ^Znf.@HH z1H H54'{1HHL% 1H <H H55z1HfAWAAVAUIATUSHdH%(H$1H|$XLD$PD$HD$HHAHJHHD$PHD$H|$DHD$pHD$XbH$Hl$AąH$U1HH}HT$HHD$HD$0HHD$81HD$H\$ D$(@|$,HD$@fD$H~Aą^|$HD$$H5D$L1Dxy LH51Xy ΉAH=@H=4L L1H HH5 xL-N H LMLGL5MGIIDLL1xHH!uտ H=藊H=p苊L Lm1H fHOH5bLxL= H L MGIIDL1 xHH!uҿ xH=9H=L jL1H HH5wH L @MEIMIDL1swHH!uѿ ߇DKHl$HtEtRt5H=H$dH+%(/HD[]A\A]A^A_ÐH}~H}>@}@fDH$;H5{ HH9uh w8}yIUH1H5~.fH={ D1HfDA1H=r{ H趉K~H=O{ AH r H3聉H3fDUHAWAVAUATSL$HH $L9uHXdH%(HE1AH8IL0ƅHDžHHHJHH0HHDHPHƅ8bH`LAM6H1H{A7oA1ɾHHDžHHHHDžHDž@HHDžf]yAąHDH5*LD1*t 蠄LH51 t 耄AH=/y D1HfiLfMtAtdtGLǁHEdH+%(_HeD[A\A]A^A_]f~n臩LfDI~{I~超@A~跉DHEIf;H56x aHI9ufD{s8hvIUH1H5>bfHL PH LPHH tPHHNuPH KH5PHJPH5BPHPHPHP1arHPLE1L=HfHS㥛 H)HH)H?) DžHHH)HHinzLH.LHLzHHLL LH)L LP1xXZHH51YqAUL1FqAU L13qIcH5HH1qHH5H1pHH5nH1pHH5FH1 pAUL1pIUH51ppHH5H1NpHH5H1,pHH5H1pHH5H1oHH5c1o 0AI@AIEHHGf{nH=t A+1H  H߂dP|H騜@UHAWAVAUATSL$`HH $L9uHHdH%(HE1AHXZILPZDžYƅYHDžYHHLHJHYHPZHDHH`ZHYHpZHHZHHZHYHZHƅXZdDžhZDžxZƅZbHZYNDYAFEiQH0[1HsAA$QEl$DEHYx1ҾHHDžYHZHYf(ZHHDžYHZDžZ@ ZDZDžZHDž ZHY(rYY0[DHYDYDH5L1DYl V}LH5t1l 6}AAEH:[DžYHYH0ZHYHHYHHYHY1HAHfDHHHH9uHS㥛 HYfHH)0ZH?)@ZHH)IHYztLY HYHL uALIiYHYYA)1kHHL FPHLPHH PHHIPHH5P1AkDžYHYH0f.HY#s C {SD{@Y΃Yf DCfYDcfYDkDYDK D[ DS DsS{D{vYwfY ɃvYAAwfAqA E1ɃvAEAw$DYEiAsE1ۃvDYAAw&DYDEiArE1҃vDYwYvYw!YWA 1vYYYw%DYiz1҃vDYAYw'DYiDR1AvDYHYWVH5AVP1AU iH0dyHY _yHYQY9YkHYHHtt?HvHEdH+%(QYHe[A\A]A^A_]~VYgH{ pH{zJ%4[I;H5 1f.*H sTك uL%H H$g@HƒfHH H*XDHH HLD\$D$AWAHAVDAUATUSHdH%(H$HH$L$HD$ Hy HD$(1HHÈH|$Ƅ$fH$HH H$ HD$ H$0H H$@H5H$XHX H$hHD$(H$xHDŽ$(DŽ$8Ƅ$`sDŽ$pDŽ$H$讵Aƅ1H\$(HcHf_1H H0HH:4@2Ht H\$(HD$(OxOxBD$ H|$ 11rŅH$stL$EAzsIcH|$HcHGcH=Hc D1HݏA |q@AtHl$EuH}seH} pHkH$dH+%(,HD[]A\A]A^A_fDEuxEtmAu xLH b H=sHl$EuH}dH}roHA$k]xPD$ |L|$HډLmH9tY4]D0Lj@}sH=a D1HApE1һLl$0E)fzHcA)AIEHD$D9HD$0L|$8AO܋D$@(E@LDT$LDT$D$DD$H\$PiDT$AyH=fzeH=e\D0xL@D$ &fHD$xD$ fLANH)D$`D$`1)D$0)D$PHD$pD$0D$X)D$@kAƍTH ^` :E1H=rUq/H=  hjِH= ` AS1H  HDT$8nDT$H _ H=L.}pMzgf.HtLUH5Hjt6H5 HjAEtH5ҿHj]øfAWAVAUATUSHH $HH-dH%(H$1H$AHHLL$DHl$ L$D$HH$HHtH|$(Ƅ$fH$HH H$HD$ H$ HDŽ$DŽ$(H$06H|$ Hi|$,HD$(DE:xE1HT$0HHD$PHHD$0HD$8H\$@D$H@|$LHD$XHD$`fDL$hh]AŅ<$D$~<APfD$EH=6H$E1.jH=wH$jH=L=M[jH=iH=<iH=i$Dl$ 1 HH<0{@&ELdH1L5L<^H$HH#SHS㥛 HHHHo^M<+ HHHHHIHHIHiH)HHHHHIHH)кZHH)1QH ]LCN1H$H y]HCfLL$DH$H$M1$HDŽ$.]HC&fMH$L9H$1$HDŽ$\DC.1H$H -\C/Y^<H H$LLº$1\DC0fE7H$H 1b\HH$8u HH9uHwgAH@D9$Hl$(Dl$ Eu3}k@H=oZ Ⱦ1HhHl$(Et̓uH}\H}FgHbH$dH+%(/HĨD[]A\A]A^A_ú;H Y H=AjH Y 3H=UjbssƄ$DŽ$| paf$xbƄ$DŽ$| xxf$pH=jY 1HjgAH >Y *H=8jHl$(Et*uH}~[H}fHAa} j`H=X A1H }H gfAUAfHATH WDUSHdH%(H$1H|$LL$D$LD$P)D$PHDŽ$)D$`)D$p)$Aąt2H$dH+%(5HĸD[]A\A]f.H$1HHHD$xHT$HHD$HD$0HHD$81HD$H\$ D$(@|$,HD$@fD$H)WAątBDHl$E#uH}YH}UdH `H5I1E1QH=÷H-cIcDSAHH@HH4HQQQPPCPCPCPPHQDPDC1DHS!QH`AS aHl$E}Qg@H=bH=V A 1H qH@d ]AWAfHAVH DAUATUSHdH%(H$x1H|$LL$D$LD$P)D$PHDŽ$)D$`)D$p)$EAƅH$H5 :HHH=Ld$aL$H$pHD$E/x1LH\$ HD$HD$D$(@|$,D$0Dl$4Hl$8HD$@fD$HXTAƅuIODH5v1GOII9jH$xdH+%(uFHĈD[]A\A]A^A_H=KT A 1H H-{b'[ff.ATA$HUH5H-4 HdH%(H$1H|$pILD$pD$$Hl$HD$D$ HH HL$H$HD$pH|$DH$HD$H$HH$HgH$HH$H$H 8 H$HD$H$H H$ HtD$xoDŽ$DŽ$Ƅ$vDŽ$DŽ$Ƅ$sDŽ$DŽ$(H$0耸Aą$Ld$H5ZL]HD$D\$l$Eۍl-Aą@D$DHT$AHH|$0Dd$dHT$0HD$8D$@8HD$Hl$PHD$THD$\fDT$e`AąH= ^HD$HxbH$dH+%(HĨD]A\fH5SL\HL\QD$t$,HD$Aċ8p@D$DHT$HH|$0Dd$dHT$0HD$8D$@8HD$Hl$PHD$THD$\fL$e_Aą+H=]f.H=]HD$D$@0HD$0HD$HD$8DE@D$DAHH|$0HD$HD$HD$TD$PfDD$\/RAąD$HѱH H5vHDʨHH HD1J"H=\Hl$Et@uH}:RH}\HX@H=t\}`fDH=L\H=pO A1H HR]H=?O A1H H!o]LH5#1IH|$A5H={]H=z{}Vff.AUA$HATDL%PUH-! SHdH%(H$1IH$L$D$$Ld$Hl$D$ HHF H|$Ƅ$oH$H VH$HD$H$HRH$HRqH$H$HD$H$HOH$HqH$0Hk{H$@HD$ H$PHuDŽ$DŽ$Ƅ$cDŽ$DŽ$Ƅ$8tDŽ$HDŽ$XH$`BLl$H5ZULbXH5G LKXsLL8XiHD$Ll$HD$8Ll$00D$@0@H|$0D$DHD$HHD$PD$XfL$\lNAąQ`Ld$H5ق LWKl$ AHD$Ll$`HD$hD$p8i@D$tH|$`D$HD$x$$HDŽ$f$Ƅ$`ZA AċD$ EHL$HT$H511EFHl$EtquH}MH}rXH*TH$dH+%(qHD[]A\A]fKfDH=WHl$Eu} \fDH5, L9VH5 L"Vl$ AtDEHL$HT$H51HE1fD$ = 6iʁDHH#D$ l$ AfDDEj@D$H HHDH51DT$Ѓt}uA< T-fHLTAWDH5a15DD$umuIu-H=4)V@H=VH51CH51 1CD$H5*1CD$wAH=H A1H SH}WH=H AA 1H "H}ViLH51!CHl$EtBuH}JH}NUHAQH=,THl$Eu}+YH=BHL$L1H5ZABH|$xOff.fATAfHUH DHdH%(H$1H|$ILD$PD$$HDŽ$)D$P)D$`)D$p)$'Aą<$HD$PHD$H|$HD$HD$HHD$(1D$ 8T$$HD$0HD$8D$@fD$DD$FbUAąDd$Hl$Et^uH}IH}SHWOH$dH+%(HĨD]A\fH=1$SHl$Eu}`WfDH5g1@lH=F H{1Ac H GTMAWAHAVDAUATUSH8dH%(H$(H(H$L$HD$1HHo[HH H$HlH$HD$H$HVƄ$fDŽ$DŽ$H$褖CH|$H5 [PH$xHT$H$ HD$HD$ HHD$0HHD$81HD$D$(@|$,HD$@fD$H@DAą$!ADAͅ.!UfH\$P)D$PI)D$`)D$p)$THLH5HHI?E@HH =1EHMH5'LH?LLOH NHQH,$EtQt4H\LH$(dH+%(H8D[]A\A]A^A_H}EH}^P@}`TfDH=OD1HSH5j=fH=C A1H Hw3QH=AO6Jff.fAVAUATUSHH $H fdH%(H$1AH$ HHLL$L$DD$HDŽ$HDŽ$D$HH|$)D$`H HDŽ$)$ )D$p)$)$)$)$)$)$誧AąD$HcA H5HlH>HL-- HL=H/IHHMu,IL$ M1LLH ~ BI1L$ LLBAąL$1۹LHLHLHHH5tL9=HtUILhL1aBAąlLHغHLLGH/LGHL$ HT$HLL$ LD$1H5 FD$ E1E11D$D$ D$H$HPH FH1L%8]AYH^LP=HHOKHHH 9D$PDL$ 1DD$0AXHZL=HHmL$H¾LLHHJH=LL1H5*E19Hl$EuH}lAH}LHGH$dH+%(HD[]A\A]A^ÐHD$DEf@D$4HT$E1H|$ HT$ HD$(D$08HD$8HD$@HD$HD$PfDD$TD$VLAąDd$EH=AJ }8O HD$D$`HD$xDŽ$8xHt$`1)FAą%H=JD8H=ID AqJ@D$ DL$DD$ DH=DJUH=!A&JHH/H=B= A,1H sH$rrKlH=Q8iDH=AIH=ƟAIAWL="1AVLAUATUSHLLo_ t$ Lg`LH= >MMMH j1H=D =L5sML1H= =ALH= 1=ALM)H=z 1M)x=DD$ L1H= W=HAL[]A\H=@ A]1A^A_+=MLH=q 1 =&DAWEIAVAUATIUSHE11ɺ2H5} MuH[]A\A]A^A_@LH{ >LH-HSHH1HÈ5I9uH[]A\A]A^A_DD$ ~KIvKHCH5׿LHIy6DD$ E1H2H5 L MtCLH L@L{HHÈCHHL6I9uHLFLJH5l H14 :EHL[]A\A]A^A_TG@AWAVAUATUSHH $HfdH%(H$x1H$pAHHLL$DD$L$D$ HDŽ$D$)D$PHH ՙH$)D$`HL$HHOH|$Ƅ$fH$H^`H )H$HD$H$HgDŽ$DŽ$H$)D$p)$袞l$H|$H5< CAHD$y@D$4H|$ HHD$ H\$(D$00HD$8HD$@D$HD$L3V$fD$ $D$ E;HfL$L=C)$H)$)$)$HI#@H5LHI3DD$ L1DL$ @L9LAH5ҚHHQ3DD$ EDD$DL$DD:HL/CLGH5i H11 RBLzDHl$EuH}\9H}CH?1H$xdH+%(dHĈ[]A\A]A^A_D$PԋHT$ HT$hD$tDŽ$x1Ht$P>YHH=]6 1DHl$EuH}8H}:CH>?L@L17L?H5kHH1f.T$ L$ H51s0T$ T$L$H541?0Hl$Eu}Ff@L1H 6L>H5HH 1fDH51/bH=5 A1H Hi1CYH~eH 4 /H=EHl$E[}EeH=4 A1H IHjiB)\$ AiHD$8aPH$Ll$ HD$ HD$(LHD$00T$4HD$8HD$@D$HD$L.AąHD$0Rx1LHl$0HD$8@HD$@HHD$ HD$(|$H9E Da}BfDEyH=,=f.H9fDH==H=Af=lEu+E1E11ɺ!H5 LEf.AHAI8HH5HI,E1E1L!LH5~ LL;Hq@H5b H1* !;HI=AH=/ Hd1A( H =qH=/ A? 1H Hsd=H=`/ A* 1H HBd=7AUATUHH $HPH-L dH%(H$H1L$@AHLILD$`DD$$Hl$D$HH|$hHH H|$D$hoHD$`H 8HD$pHD$H$H)H$HH$H\H$HD$H$HUD$xDŽ$Ƅ$sDŽ$DŽ$H$ߓ0HD$DE*@Ll$ D$4HLLd$(HD$ D$00HD$8HD$@D$HD$LG)A$ELd$H55L8HD$fHD$ HD$D$(8D$08D$8D$H@D$4LHHD$9rD$#AA....AD......fATT$HL$TT"AWIMAVIAUMATUHSHL|$PAGAăAA0A ĸMCHIIHHfH*$$H$H 1H D*H ك uL OH yHL\$L$L\$IGH yL$IH6fH*$$1 +H Pك uLNL׾HACHL J I2LMIMHH1L9~Ht3 HHL9HcHHLML1HHIL MH d|HL1IE@EHEHEfHЀ8 u HPH9uH[]A\A]A^A_DHƒfHH H*Xf.HƒfHH H*XfHHF HLD$$HHE HLD$$AWA?HcAVAUL-{ATUSH/HdH%(H$HwH$D$WD$VD$UD$XHD$hHM<HD$`1HH5>DƄ$oH$H)>H$H$HD$hH$HzH$HD$WH$HzH$(HD$VH$`HzH$pHzH$HD$UDŽ$DŽ$H$Ƅ$sL$@Ƅ$HHƄ$dH$HH$H=H$Hc;H$HD$`H$HOH$HB=H$HCH$(HD$XH$8H=DŽ$DŽ$Ƅ$ vDŽ$0 H$HQAƅt2H$dH+%(=HĸD[]A\A]A^A_fDt$XH=- FC11҉5Z H|$hHt$\.gAƅx|$Wu |$Vu|$UuD$UD$VD$WHD$pHt$`HHD$(HD$xHD$p_RAƅ:D$\tLsHl$pH\$(H9HUHEH}HBHH0Hl$pH9uD$UD$9D$VD$:D$WD$;HD$pHD$ H;D$(Dt$0HD$ H5"H@HH$H1HC0HtLH8tF|$;|$:|$9}HD$ HHD$ H;D$(e 놐H$H@8HtH8uH$H@@HtH8uH$LpHM1M.M%|$;wDH$HX@HrL#MfA I|$DI|$ H9DGH9GLcHMuH=wHEDHb*L wPH3wH5w1UUl HDAHH5w1RID HD$ZYL`@I$HHwDHLHp EUDH޿UI1 I$H HuafDH$Lh0M?MeM2AfI|$I|$FA9DBI|$p9B9BMeIMuH=3vxHHBvL )vPH7vL#vUH uHuUH5PHSSPH vPH vAVAVP1 H`1HSH5$RIIHURSRRAVR HD$@H@L`0I$H+EPLXpLPFH5tL\$DxEH tHEHLpILT$DHLbuHL$H=% RPRPRPR@P1=ID$H(E1L5s @H=% ƒRRP1L\$8HID$L r% L[% ASHHH51UULT$0ARSSAWAVAUAU1t$` I$H`HH$LpHMM.MAI}xI}0H9GvLH9G1DH9DGMnIMuH=sA؉ٿH}sL &PHsHsATH59ATPHiPHsUUP1 H8HH541RIIATRRU HD$0H0LhHI}HL$L= LIIEALHP0LHxAVATATpXRHP(UUR1! I}H@HutDt$0fDH=rbD$UD$;D$VD$:D$WD$9`HD$ H HD$pHD$H;D$( Dt$ HH; #L|$A(H5rHH A)H5xrHHAG, Hp HHH5YrHH<$HH5[r|$9|$:U|$;H4$H|$ uhHD$HHD$H;D$((HD$LxL|$-H$Ht=IHt HHH<$H5q!ifH<$H|$ AfHxfDHpHHf;HD$0HtHD$H@HHD$Hf.HD$L0MZHH^IHt9AFE1<@IE9~~.IF J8LH<tH A>H59HHuA~H5pHHuLH5}pHuI~(lH510HHzI~0IH5X0HHWIVXHt HHH50H\,A~`*H5oHH8A~dH5HHH$fHDŽ$HD$@)$)$AFh#H|$@gH5HHuI~xHt?H5_oHH}MAIH5+oHHW'A#H5oHH1IHtH5oHHAH5nHHAH5nHHAH5nHHaA\H5nHHj:H|$0He]HD$fIHHD$L`0MDI,$HIH} H55LHLELLD$wH5<-LHH|$H5, EHE1ɾ Lyj H= ƒRRP1C H H= H5mLH1YEHDMLkPEH=z PEPEPEP1H0H=X H5mLH} H5lLH}m H5lLH{H}H5TmLHX}E' H5lLH5uaH}FH5lLHuB}n H5lLHu#H}pH5vlLHLX>IHHD$Lx@MFA<$o H53HH}ID$Ht!8D H55lHHRZID$Ht8 LHH+3I|$HtH5kHH I|$ HtH5*HHHLIM'Mt]HH HT$0H<$HH|$0 dH<$LLeL0H<$LH5hBDt$H$ HH$8HH$HHD$XH$XH{H$hH$HHD$Ƅ$@oDŽ$PDŽ$`eAąLd$XL+D$0Hc 9E1H U Ht$@HH=LcE (1LH$HJL|$ E1L$HD$0ID$HL XLHD$HLY J HP1A[1[L1 ŅNHc\$Lt$`HD$`Ll$tHi(1H$D$p0HCƄ$HD$hHHD$xHDŽ$DŽ$-HsH=TH~Ll$tHHD$`HT$hD$p0HD$xDŽ$$DŽ$Ƅ$M1IH= L1HzfDIM9lDT$L|$ EiD$H$HH\$H{HHHHH5u߀{81fDL$H$)$foA HDŽ$ HDŽ$H)$0fo?HDŽ$ )$@foHDŽ$)$Pfo׎HDŽ$ H$H)$foHs, %s, %H$`H$0)$foHDŽ$DŽ$Ƅ$Gs f$hƄ$jfD$ HD$)$EW D$L$$XHi(1I(1fMt#M$0LLH I(1I9uH$L\$`L$L\$(L$pL$LxH,1HD$ H$H$HD$H$pH$HD$HMLLIPLD$8Ht$ H|$XI ZLNI HHLHEOIAVI0H1ATI(1t$(t$(AUHt$HqH0L9|$ jD8H= LHOI1R1aIH=G L1HNvt@H ! H=PHl$01@HD$@H<HH9uH|$@E1H<$H$dH+%(= HD[]A\A]A^A_H|$HHcyLL$H1IyLIIǁHH)HLLL$hHLL$(D$p0HD$`l$tHL$xDŽ$$DŽ$Ƅ$LL$(t1LL$(LL$(IL1LL$(H= HuH|$(lH|P IHL\$`H1HL$HLH5 LH{MH=9 1AwOf؉7I4؉IH (H=ufD1fH$HDŽ$ HDŽ$H?HDŽ$ HDŽ$)$@HDŽ$0 HDŽ$8DŽ$PH$HƄ$TGHD$8L$$HD$D$hHi(1I,(1Mt#M$0LLH0I(1I9uH$L$pL\$`Ld$(L$L$0LH(0AHD$ H$MH$HD$H$pH$MHD$fHM$MLATHt$ H|$HT$8XLZI$vI$HHsAt$MHA4$I$ HI(1E$оAVt$xH|$8H L9d$ kH\$8HT$H5) HH߾H5a H1O HmAoIL +H 13HfHDŽ$H)D$`Ht$dL)D$pHT$x1)$D$`H$)$?H0L!D$H H=IfD1fDt$H$)$fopAs HDŽ$ HDŽ$H)$fo?HDŽ$ HDŽ$)$fofD$PL$)$fo!H$H)$0foH %s, %s HDŽ$p HDŽ$xDŽ$Ƅ$H$ GƄ$(Ƅ$R)$@E<D$L$$XHi(1I(1fDMt#M$0LcLHx I(1L9uH$L\$`Ll$L$pH$L0ALH$pLt$MH$IMfLLLzILIHHATE1AVHt$ II HI(1!_AXL9l$uGH=K HH11H=QU&H=VL$W1H8H$HD$@DH0Hwu Hc4@HI9uH|$@HcɺH$@Ƅ @{Lt$x/LٽH:\LIH!A<$/DA|$8H$$HD$0H$4HD$H$HD$HHh HD$PH$ HD$ 1 H<$H$8HHtIH$DHAVHfoAL$w$H2SIcGHD$HH|$觭HHHD$h8x1H$HDŽ$f$(HDŽ$H$DŽ$@$ DŽ$D$$DŽ$HDŽ$ .Eg A)EL|$EL$`L|$ @EH eL1Ll$赫HD$MLHH?HD$h x1ҾHDŽ$f$(H$HDŽ$H$DŽ$@$ DŽ$D$$DŽ$HDŽ$ 0u!E=ﾭtA)E=ﾭL|$HL;|$(tEgIELd$xH5OH$`L虥HH\$1IMH 1HzH貭BHt$0L,H\$1IH H1Hi H=UADHD$hDEDhHD$1H$ff$(DH$H HDŽ$HDŽ$DŽ$@D$ DŽ$D$H$HDŽ$ )$4)$4{D$4D$4$4$4E8SEJB9A H D9C EDL$I L*DL$HHL@ Dɺ Dfo$4D fo$4X$ $4X E=ﾭH$`HD$ELt$1H LMIHT$ MHx11}jH= 9tfo`GƄ$4Hre instaH$4)$4foFGDŽ$4lled)$4HL$H=G Hx>1脰kH5QL虞HH\$1IMH >HzH貦 foFdf$4)$4foF)$4UDE xH$E1ɾHDŽ$HDŽ$H$DŽ$@$ DŽ$D$$DŽ$HDŽ$ fD$(ĠjA|IFfDHa\u8\ufH=ɠ AD1H;]H 8H=8螱dHT$ H|$LR H U -6}HT$ LW LH =  6H$$HD$0Lt$@L11MHfLc΃B `H9~A  wHsH$`HcLl$H$4HD5L|$IAL5 IHT$A諚8AELL1ALHHsxH$ILl$HHD$HI1H5l L  L|$Ht$PH舠LRH$ HL$PL tHHD$ II1@LӝH|$HAH9@LxLHmM9&)ō}Hc'IH HcLHH芞A,A$t@\u/PHuL HHA|:QH$$LHHD$0L裦H=':蒪,Ll$L|$H|$HHIiHLqDHH M3LE/LIHDH5911H] H$@ H$X H H$ HF H$h HH$ H;H$p HO H$( H H$ H H$8 H H$ HƄ$ DŽ$ Ƅ$ Ƅ$0 Ƅ$H H$P Ƅ$` Ƅ$x DŽ$ Ƅ$ DŽ$ Ƅ$ H$ DŽ$ fH= A 1H <H?H=N4yH Ƅ$ H$ H?H$ H H$ HH$( HH$8 HH$@ HH$P HƄ$ Ƅ$0 Ƅ$H H$X {ẢT$I L$LL$T$HHfo$4DbA fo$4 h)EXED茣H$4HD$}HcoIHHLH/LfA4.Hc=H5IHQHLH諞LC HHfo$4$4 fo$4u}LA( 1H=י H :L@ DDL$L$DI HfD1H= Hɧ&Hcɺ DDLD DDL$dDL$EC CH=4 A 1H 9HdbH=9~ Q H=9LK H=~9A^茠H= D1HHgD, H=69AAuH="9 DD$#DD$|H=9* 1 H=8D$5+ H=8ALu H=8A8H=8g / H=8A.H=k8k qT H=N8YARH9H$ HD$ wELH=j H21觥HT$0H51LE Ht$0L6I.LПLHPf.v#wHrHcH>u H =@wCHrHcH>H'=H;<H<Hi;H;HRH;Hz;HRHC;H;H;H;H;H;H;H:H<H9RH;H;H:@wHkq@HcH>DH7<H;Hb HQH<H;Hk<HN<H RH`HQH<H;H;HB<H<Hg<HH<H<H)<H=Hs=H=H<H<H<H<Hf<HQH<H<H1HQHQHqQH<H<H%=H:H:H<HRHQHQHQ:AUATL% UH-A=SHH=QHIH <1H<H5<H1H<L1DkH1H<ՍLL1L-<輍H1H<覍SL1蓍H1HbQ}HKHSL1fH1H]QPHKHS L19H1Hb<#HS(L1H1H/QHS0HL[]1A\A]݌ff.fH1H5Q諌1H@H1ɺH5P1~1HATfULHH(DdH%(HD$1G)$IPGLP1)LHt9LٚH5Y;HHHD$dH+%(u'H(]A\LH56;1‹˘ff.H5AWA$HAVDAUATUSHdH%(H$H$L$HD$(1HHxH|$ Ƅ$nH$H,H OH$HD$(H$HH$HH$HD$,H$H0H$H H$ HD$-H$@HlDŽ$DŽ$Ƅ$bƄ$(jH$P>AąaHD$ l$(nxH\$pHT$0HHD$P1HD$0HD$8H\$@D$H@|$LD$Xl$\HD$`fD$hAą|$-U|$,HD$ L$(IH5NHl$jH1诉H= 賛H1fDP HHHH9uT$sH5(1lH1PHHHH9uT$H5(14$1$H56D$D$H1f.P.HHHH9u$H5=1H1@P:HHHH9u$H5=1艈H1@JFHHHH9uH3fH*Y$H5Z0H1PRHHHH9u$H51H1@P^HHHH9u$H51$1$D$H5(薇H1ɐPvHHHH9u$H551aH1@HHHH9u$H521&H1ɐHHHH9u$H521H1fHHHH9u$H521讆H1fHHHH9u$H5K1nH1fHHHH9u$?H5K1.H1fHHHH9u$H5K1H1fHHHH9u$'H5K1讅H1fHHHH9u$3H5K1nH1fHHHH9u$KH5K1.H1fHHHH9u$WH5K1H1fHHHH9u$cH5K1讄1@HHHH9u$oH5K1v1@AHIHL9u${H5K1=Hl$ EtfuH}ӋH}jH"H$dH+%(: HD[]A\A]A^A_fD~׹Hl$ Eu}#말H$;H5 H͙H9uVHD$ LHD$Mt L=IH|$LH51L=[ Hl$jjEI=|$sIHD$+LLH=H$H1@P HHHH9uL5 H|$HLHT$H5Lǘ|$HD$踍H|$LHȃH1PHHHH9u臍H|$LH藃HT$H5dL胃^$HD$LLD$LHLLD$T/$HD$H|$H51 H)$H|$H5" H$یH|$H5 HLD$HT$LLLD$͂HT$H5L蹂蔗$HD$肌H|$LH蒂H1DP.HHHH9uOH|$LH_HT$H5CLK&$HD$H|$LH$H1P:HHHH9uߋH|$LHHT$H5ۄLہ趖$HD$褋H|$LH贁H1rFHHHH9uH[fH*YZ衅H|$LHaHT$H5]LM($HD$H|$LH&H1PRHHHH9uH|$LHHT$H5 L辕$HD$謊H|$LH輀H1P^HHHH9uwH|$LH臀HT$H5LsN$HD$H$HfD$XwH$Ƅ$bH$AąHD$|$xHT$|$,H HD$81H$0HD$HD$H\$ D$(@D$0l$4HD$@fD$HN{Aą$0D$2ffu fAx|$HHc HDH5B1uHl$Et_uH}}H}+HH$HdH+%(*HXD[]A\A]~蟫Hl$Eu}ffEN|$|$HѷH2c HDH5<1E1H-%7uH=;$0H5O%1u$2H5I%1tH=<fBLDH1ItI uH=<E1BDH1ItIuH=<E1荆DBDH1IZtIuH=$X$11H0tH=$4$11H tH=$$11HsH$;H5x HH9u|$|$H Hla HDH52;1E1H-#qsH=Bu$0H5#1Js$2H5#1/sH=;3BLDH1IsI@uH=;E1BDH1IrI@uH=u;E1̈́DBDH1IrI@uH=m;E1蕄DBDH1IbrI@uH=e;E1]DBDH1I*rI@uH=U;E1%DBDH1IqI@uH=M;E1DBDH1IqI@uH=E;E1赃DBDH1IqI@uH==;E1}DBDH1IJqI@uH=5;E1EDB DH1IqI@uH=-;E1 DB DH1IpI@uH=%;E1ՂDB DH1IpI@uH=%;E1蝂DB DH1IjpI@uH=%;E1eDB DH1I2pI@uH=%;E1-DBDH1IoI@uH=;E1DBDH1IoI@uH=;E1轁DBDH1IoI@uH= ;E1腁DBDH1IRoI@uH=;E1MDBDH1IoI@uH$4H5:1n@H$<;H5s HH9uH=s A1H UHި,{ff.fAUAHATDUSHdH%(H$H$L$HD$1HHj[HH :H$HH$HD$H$ HH$0HH$HHD$ H$hHƄ$nDŽ$DŽ$(Ƅ$PbH$xWAą H$\$xHl$PHT$HHD$01HD$HD$Hl$ D$(@|$,D$8\$]LH X H=4iHl$EuH}ZH}eeHAa$H=;X A}1H 9Hkf66H X H=$Ah}i늾UH=9莄H W H=AhH|$w`_H=$ANdH|$Q\H=9`fAWA6HAVAUATUSH?HdH%(H$1H$PHt$hHD$h1L$PHHL$`H$HH$pHhH H$HH|$8H$PH}H$H$HH$HL$lH$`H$H5H$H+$HD$`D$pHD$xƄ$XfDŽ$hDŽ$xƄ$nDŽ$DŽ$Ƅ$sDŽ$H$HL$pH$HH #H$HD$xH$H'H$(DH$XH #H$HDŽ$Ƅ$0pH$pƄ$xoDŽ$DŽ$H$ΦHD$`HD$HCD$pHt$xD$Ht$ t HSHD$8fHD$PHDŽ$l$lD\$hHDŽ$HDŽ$DŽ$@)D$@E@E1$ۿ$H H$fD$DŽ$EHDŽ$AVHD$HHCAEH$H$$HHD$@DŽ$H$bbAąwAEH$HD$@H$;bD$,HD$H@D$(HD$@HH$IHH|$H5z[IHD$D|$(E1L$u@H$a$AąH$L:d$II9AffA)DH*D$(H*^ϴEvDH$D9p$H$1SDRfAH$dH+%(HD[]A\A]A^A_ÐA$HD$@H=iR H$H 1`H|$[Ht$@Ht|$HH|$PtbZHl$8EtAuH}TH}_HZPDD$(+D}bfDRfAcDA$HD$@H=Q H$H 1_Dd$,&H=4^E1|$LXfH=9Q AADH 1m_H Q H=  bfH P H=8Aa.H P H=AakHt$@Ht'|$HH|$PAYHD$@HD$PDd$(H4$L~HHLVH|$H5XIH2HLH\I9t%H O H=u`E1HkHmH|$ H$H5xH$HqH$HmH$HmH$HvH$HrH$HH$H}H$HH$ HH$(HH$0HH$HH$8HzH$HH$@HrH$H$HVHD$H|$(IiQHBIEVTLOGH$H%HD$L9kt*A1Dt$D9|$(zHL9kuH8H9Cu1@HHHLDKOHM{HtCH HHCH41HLfo0HIHTH|HHCLyBP1hOHLS8Y^3K:H|LfH1QL|HOXZH6LHL$HHHD$ ,^H9D$ H M ,H=^H|$SDd$,DffH*I*^袮HD9|$(3H=\wYM*L$(H=L H1ZALH1#NH|LGLHD$@H=)L ASH -H$H 1UZESAHL$H=K H@1ZAoHL$ H=K H^1YD$,HL$H=K H21YHsAWAHAVDAUATUSHdH%(H$HH|$xLD$pHD$ 1HHErH|$(D$xoHD$pH=rH H$HD$ H$H4IDŽ$DŽ$H$.OL-: H|$ LUHD$(DExH$E1HD$0HD$@HHD$PHHD$XHD$0HD$H@HD$8|$LHD$`fDD$hHD$ID$D$D$HD$(0xHT$1ɾ|$LH$D$H@HD$@HHD$PHHD$0HD$8HD$XHD$`fL$hID$fL$L$11L5aI M9A<H H Ht$(H=f=AąBHLHHD$HD$(HtHADT$uCD$Hi1Mi @HŰRHcHIŰRH1HLHID$fH$)$$D$ )D$PD$TH$)D$`HD$hH D$P )D$pHD$tAL$HDŽ$)$IA~Ht$P1_@AąLl$1IfHD$(H<(H@I9uH|$(@EHl$ EuH}:H}DHg@H$dH+%(HĨD[]A\A]A^A_HT$ B(%=  HHA6 1H|BHl$8D$0HtH 7 H= A HHl$ E5}H?fDH 6 H=AGL$0HH51V1HI LD$ LKP148Y^"D"H L6 H= AEG,$H $6 H= AGqH 5 H=FDfH=5 AA1H 0HjCp=AWAVAUATUSHH $HdH%(H$HAH|$hHLD$`DHD$1HHy\H|$D$hoHD$`Hq\H  HD$pHD$H$Hk3D$xDŽ$H$hAąHD$0x1HT$ |$@eH$HD$$D$ fHD$H6G @DH5D͛H1+D1H5J+@$H$HD$$D$ fHT$H5\ 1V+fDA&HD$hdH+%(;Hx[]A\A]A^A_@urH$HD$$D$ fHD$H4F fH$HD$$D$ fHD$H F @u8H$HD$$D$ f`HD$HE @nH$HD$$D$ fHD$HjE GdLl$Lb LLHL@#10LH1L=Ld$@)Lde1L5gH-)LL(L D LD 1S0LH1q)Lca kLL#L@10LH޿13)L1)LL(L UD LFD 1/LH1(L` LL#L@1/LH޿1(L1(LL(L C LC 1A/LH1_(LQ` YLL#L@1/LH޿1!(L1 (LL(L #C LC 1.LH1'L_ ЗLL#L@1z.LH޿1'L1'LL(L B L{B 1/.LH1M'D$ JD$ D$ D$ ND$ 41@u3H$HD$$D$ fHD$HA g@u3H$HD$$D$ fHD$HA .@u3H$HD$$D$ fHD$HjA @u/H$HD$$D$ fvYHD$H-A @%Ƅ$H$HD$$D$ fv HD$H@ D$ fD$ f.D$ D$ D$ 6T$ AWfL=?AVL5EAUATUHSHLkHXdH%(HD$H1)D$ )D$0HD$@2H5HHI)&HHD$I L;l$:A}H@tHHt H3HLH%A}/LHH%IEf;HD$AED$yH|$w/H5hHH%HL5AEIEf;HD$AED$HD$H? I L;l$9dHl$ HHx2LHH$de.HLH$(H1L > L> H Ia*HY2HH5wH$HL4g9HjHx!2LHHc$9.HLHK$(H1L > L> H )H1HH5H$HL 48HےHx1LHH#-HLH#(H1L s= Ld= H +C)H;1HH5YHy#HL~3I8HLHx1LHHE#-HLH-#(H1L < L< H (H0HH5H"HL27H轑Hxt0LHH",LHH"(H1L 5< L&< H %(H0H5>HH["HL`2HD$HdH+%(eHX[]A\A]A^A_D|$<IEf;HD$AED$HD$H; IEf;HD$AED$HD$H; @IEf;HD$AED$}HD$Hy; t-HD$(dH+%(uH8[]A\A]A^A_(f.AWAVAUATUSHH $HHdH%(H$81I1H$9)LHD$HFH$HD$ 1L$HHGH|$(Ƅ$oH$HGH H$HD$ H$HDŽ$DŽ$H$qL-̖ H|$ Lt+dHD$(DE@Ld$0D$DH$0HLHT$8HD$0D$@0HD$HHD$PD$XD$\dAƅ o$HH$hH o$XLHl$pH$L=0)L$p)$$fI9L;HL8HLHuHD$(WxE1L|$LHfDT$hH$0HD$PHHD$0HD$8Hl$@D$H@HD$XHD$`\Aƅ H|$ L) LZH c1HH5[P-)u )Ic1A)$0H@@AH0HHPH$@ D$;AXAYA*uHD$(8xH1L$0LHD$PHft$h|$LHD$0HD$8Lt$@D$H@HD$XHD$`)H|$ LD (xL贉HD$(x1L|$LH$0D$H@HD$@HHD$PHHD$0HD$8HD$XHD$`fL$hDže~MH$0HD$(DExE1LHl$@HD$H@HD$PHHD$0HD$8|$LHD$XHD$`fDT$hAƅwH|$ L'LH 1HH5PD-.'u 'Ic1A)$0H@@AH0HHPH$@ D$AXAYA*uHD$(8xH1H$0LHD$PHft$h|$LHD$0HD$8Hl$@D$H@HD$XHD$`H|$ LAƅnQ&HQHl$(E5uH}BH}'H#&H=I|'YKH$8dH+%($HHD[]A\A]A^A_DH|$ L%H= H-'H >1HH5L=H1HL5E L1H$0H$8H4H1HnL1H$@H$H`H1HJL1H$P3H1HL1H$XH1HL1H$`H1HL1H$hH1HЇL1H$pH1HiL1H$xRH1H<L1$%H1HL1H$HH1HL1H$H1HH޿1$H1Hk$1D$$H5ZD$OH1H9L1H$"H1H  $H511HH$H5:1H1HφH޿1$H1H~$H5^C 1cH1HML1H$6H1Hc L1H$ H1H;L1H$H1H!L1H$H$H1HL1H$H$r1HH\L1H$EH1H/L1H$H1HH޿1$H1HdH$0L1H$ H$(+fEfD{EHl$(E}%fDH<$$H59G H1'rf%HHIH\$H<$H5HLH pH$QHw$H5F H1HY!&$HHI!H\$H<$H5LHLHd$H9H$0HD$LT$H5HILLT$L'$H=IHLL|$HL=f(1L$0L$8HL)$0L)$@HDŽ$PHxH|$LHHt$L#H=iHD$EH|$HHf(1L$@L$HHL)$0L)$@HDŽ$PHH|$LHHt$L""H==HD$H|$HH $PH|$LH Ht$L"H=HD$]H|$HH $XqH|$LH Ht$LO"H=jHD$H|$HHN $`"H|$LH2 Ht$L5"H=1HD$H|$HH $hH|$LH Ht$L!H=HD$pH|$HH $pH|$LH Ht$Lb!H=HD$!H|$HHa $x5H|$LHE Ht$LH!H=HD$H|$HH $H|$LH Ht$L H=xHD$H|$HH $H|$LH Ht$Lt H=8HD$3H|$HHs $GH|$LHW Ht$LZ% H=FHD$H|$HH$ $H|$LH Ht$L H=HD$H|$HH $fH)$0H )()$@HDŽ$PP$P1D$D$%XHZH|$LH[ Ht$L^)H=hHD$H|$HH( $H|$LH Ht$LH=}HD$H|$HH $H|$LH Ht$LH=HD$JH|$HH $]H|$LHm Ht$Lp;H=S}HD$H|$HH: $ H|$LH Ht$L H=HD$H|$HH$H|$LHHt$LH=HD$ZH|$HH$nH|$LH~Ht$LLH=|HD$ H|$HHK$H|$LH/Ht$L2H=9HD$H|$HH$H|$LHHt$LH={HD$mH|$HHf(1L.L$HL$L)$0)$@HDŽ$P HH|$LHGHt$LJH=t{HD$H|$HHf(1LL$HL$L)$0)$@HDŽ$Pv HnH|$LHHt$L|H=ԾHD$;H|$HH{$OH|$LH_Ht$Lb-H=HD$H|$HH,$H|$LHHt$LH=PzHD$H|$HH$H|$LHHt$LH=zHD$MHH\$HHf(1L L$ HL$(L)$0)$@HDŽ$P HLHH&HL+L|$H$H5LHHt$LHHIH|$LYLHIH|$LH<$&H5r; H1`H= A1H Hv=H=c A1H HE=1H=SjAH= A1H TH<KH= A1H #H<AH= A1H H<{H= A1H Hj<!)fAWAVAUATUSHH $HH $HdH%(H$!HgAH$HL$DHD$H1HH.H|$PƄ$oH$H .H H$ HD$HH$0HDŽ$(DŽ$8H$@WH-} H|$HHHD$Pdx1Ll$`|$|f$LHH$H$HHD$`HD$hH\$pD$x@H$HDŽ$}D$$tm~ |$$z6Hl$PEuH} H}H[H$!dH+%(D$$Hĸ![]A\A]A^A_fDH|$HHH$HH$HDŽ$Ƅ$HDŽ$Ƅ$H=L=HL 7PHWL0PHH 'PHGH)PH5^1WEH$HH-lH HD$ H HD$XL$L$HD$HrcHD$HHD$H$HD$(L1H@HSH|$HS㥛 HHHHT$XBHT$LLoP)\$`o`)d$poh )$H@0H$Ht$L1]HSҿ1H5BFHCLH58Ƅ$H$1HCHT$(H5Ƅ$H$1S1H5S1H5߷SH1H9$Hl$PE+D}0H=!YcHHD$8 H5HHHD$(_$xHD$XLl$0E1H$HD$HraL$HD$HL$HD$H$L=4 I@D ${HDŽ$HDŽ$HH5HHHSH|$HS㥛 HHHHT$XHL$0HT$LoP)D$`oH)L$poP )$H@0H$nHt$L1L H5HH {H5DHHILL1L H5HHLCLL1H@cL[ H5HH{pH5HH~{UH5HHc{:H5~HHHH|$(HK D $AD;$-H\$8HLH1H Z@H= EH=L=2 H= A1H H4 nH=av D$$d@AVAUATUSHH $H dH%(H$1AH$HL$DD$HHH|$Ƅ$sH$HD$H (H$HH$tPJHD$ @Lt$D$$H$HLHT$HD$D$ 0HD$(HD$0D$8D$<6Aąko$(H$HHkr o$8LHl$PHD$pL%)L$P)T$`I9t{L#HLHLHnAąuH= Hl$E HH$dH+%(iH D[]A\A]A^HD$fHD$HD$D$D$ 8D$(D$8@LD$$D$0D$F AąZH=N 1H %H E0H=':D 8f-*@H}gH} f} H= A1H H1 H=^A` H= A1H UHf1 %DAVAUATUSHH $H dH%(H$1AH$HL$DD$HHH|$Ƅ$sH$HD$H H$HyH$4M*HD$DE@Ll$D$$H$HLHT$HD$D$ 0HD$(HD$0D$8D$<Aąio$(H$HH)o o$8LHl$PHD$pL5í)L$P)T$`"I9gL3HLHLH"uHD$l$@H\$LAHD$H\$D$ 8D$$HD$(HD$0HD$8D$@@l$DfDD$EHD$l$8@LH\$HD$D$ 8D$$HD$(HD$0HD$8D$@@l$Dft$EAąHl$EuH}(H}HwH$dH+%(H D[]A\A]A^DHD$fH\$D$H\$D$ 8D$(D$8 @LD$$D$0D$FH= H Hc1Of.H=D 0)@} H= A1H ]H-H=ZA@H=d A1H HF-H=3 A 1H H-cH= A1H H,21AWA$HAVDAUATUSHdH%(H$1H|$pLD$pHD$(D$$HHuHL$$D$xnHD$pH|$H%H$H$HD$(H$H6H$H H$H H$H AH$HD$,H$H H$ H$DŽ$DŽ$Ƅ$iDŽ$DŽ$Ƅ$bH$0HAą)\$(HD$l$$8\$(xHD$01l$\L$ft$hH¾HD$0HD$8Ld$@D$H@|$LD$P\$TD$XHD$`H$ŅS$|$,D$L HL$AE1uSM|$,Dl$ H51U=t$ LQ|L99\$݋\$)9OLcI LMIH;HD$@HD$Lt$0D$H@HD$8@D$LD$(H<$Dl$XD$TD$$D$PD$\HD$`fD$hAą ]f%0AP%Hl$EuH}H}yH1H$dH+%(HĨD[]A\A]A^A_DHD$L$(H5ADD$$H1$1$H5D$Lz f.H=AQHl$E!}+@IcLHHH51H=)H=8 A~1H H(hHH5E1.H H=GHl$Et[uH}(H}HAq;H= AN1H 6Hw'},ff.AWAHAVDAUATUSHXdH%(H$HH|$hLD$`HD$1HHH|$D$hnHD$`HH oHD$pHD$H$H*H$H-H$HD$H$H{D$xDŽ$Ƅ$bH$BAą'HD$\$8xH1L$@HD$ HD$@HD$ ft$XH¾HD$(Ld$0D$8@|$DŽ$DŽ$Ƅ$fDŽ$DŽ$H$=AąH|$(D$ ?KHD$\$ 8Zx1L|$0|$LHft$hLH$PHD$0HD$8Hl$@D$H@HD$PD$X\$\HD$`}AątvpyHD$(8Hl$EuH}H}HLH$XdH+%(HhD[]A\A]A^A_$\|$ HD$sHL$8H$'@JLAD9d$m\$D)9OLcI LMUIHH$Lt$@HD$8HD$0HD$D$H@L@D$LLHHD$PD$ Dl$XD$\HD$`fD$hŅ3|$ IcLL,$pH$HH5^1A1D$ H|$(AsH|$qH@H=T}|$ f.AHH51/fH=)H=8 Aw1H HhH  H=fA-E1%H= AS1H HHxxAWAHHAVfH5AUATUSH3HdH%(H$1H|$p)D$ LD$pHD$0D$ HHL$ D$xnH'H$HL$$H=:H$HKHD$pHH$HRH$HL$(H$H$H$H5H$H H$H$ HL$0DŽ$DŽ$Ƅ$fDŽ$DŽ$Ƅ$sDŽ$DŽ$(H$XH$HD$,H$HH$0H5tH$HH$hHL$4H$xH5H$ HD$5H$HHCH$H nH$DH$H|$H$@HgƄ$PlDŽ$`DŽ$pH$Ƅ$bƄ$cDŽ$DŽ$Ƅ$(HH$P7AąDd$(ADl$$EU\$0Lt$1HD$ Hl$HHD$@AD$P0AFD$TD$ H|$@Dd$`D$\D$,D$XD$d\$hDl$lD$mAą AY1H H n},벋}"1VDH)VwH/ff.H.ff.g!%wg+G/ATfHHPdH%(HD$H1H)$HD$@)D$)D$ )D$0wUAąt HD$HdH+%(uHPDA\fDH=4-ff.f2AUAATAUSH(dH%(HD$1&H|$HcHl$1HE1E11ҾH}HHEHDžHH)HHD$DPjjjUhjjjjjjjHpAŅDEH HmAu]u3H+HD$dH+%(H(D[]A\A]fDEA tEAuuH H:H= 1AA @H= A1H EHLzf.ATAfHUH DHdH%(H$1H|$LD$PHDŽ$)D$P)D$`)D$p)$,YHD$xAąHD$fHD$HD$D$D$ 8D$(D$8*@D$$H|$HHD$,D$FQAąuBHl$EtptyHaH$dH+%(HĨD]A\@H=a H ZH1E~D Hl$Eu}F@H}H}pH= A!1H H2H= H HK1AH= A'1H HFfDAVH5' fA~ƿ[USFfAnY/ H,1=HHFt H5 H9s HHFufAnf1ZYH= HA,H= []A^i\m H,H?kfAWAVAUATU,SH<$DD$ DD$ 9EAL5D$6L-HL=fLAHD9tcDLD#$L1HS1LD;d$u|$ t AH"D9uD|$ uH[]A\A]A^A_fHH=a[]A\A]A^A_vfDAWA$HAVH5.AUATUSHHdH%(H$1H$L$D$ HD$(D$0HH,HL$ H$H$HH H$HL$(H|$H$H$H H$ HD$0H$HH$DH$H H$0HkƄ$nDŽ$DŽ$Ƅ$oH$DŽ$DŽ$Ƅ$lDŽ$(DŽ$8H$@'D|$0AEH p H1AtxH= 1A/Hl$E!uH}1H}HH$dH+%(?HĸD[]A\A]A^A_@D$ Ll$(Lt$D$ yH|$HcGAą\AHl$7A~ÅAEA~D$ HT$@HD$@HD$HD$l1Hl$PD$X@|$\D$`D|$dD$hHD$pfD$xfÅ M;AL1AƅHcHDADž29')uDktbHtHLDD$01AH= H vHR8fE1A H= H :H{D~Hl$E}H= E1H H9H8CfDAt_H2ZHjHE1ZfAH=& M1DH gHVL$ I1E1H5QU1H5U1H5qU1H5ZU1H5CU1H5,U1H5µU1H5ĵHRH=* H H1AZUH= A1H ?H.H= A1H HH= 1MH HWHtHBDD$0H Hb%DATAfHUH ҴDHdH%(H$1H|$LD$PHDŽ$)D$P)D$`)D$p)$i"@HD$HxHT$H$HD$HD$ HHD$0HHD$81HD$D$(@|$,HD$@fD$HAąthHl$EtLt/HH$dH+%(HĸD]A\fH}H}@} fDH51$AŅRAtoDH-U HD$IAH=& H ?H1\AtDHH= H HK1H= H Hu1H=` M11HA@HUO=H=i H H1LAH=@ H YH1vH= H 3H91PH= A1H H$D$ H= H H:1AfLD$H= 1H HHAH2 ff.fATAfHUH DHdH%(H$1H|$LD$`HDŽ$)D$`)D$p)$)$ffH$Ƅ$)D$ HD$(H)D$0HD$4HD$)D$)D$@HD$PD$‹D$@ZxHt$1AątoHl$EtSt6HH$dH+%(HD]A\fH}H}@} fD$H51qH='AkH= AN1H HSATfHPdH%(HD$H1)D$ t$$)$)D$)D$0HD$@$D$HL$t$(T$0EuD$8H1`Aąu!HD$HdH+%(u8HPDA\H $H=Dff.ATfHPdH%(HD$H1)D$ t$$)$)D$)D$0HD$@$D$HL$t$(HT$0EuD$8H1Aąu HD$HdH+%(u7HPDA\fDH  'H=h Dff.AWAVL5>AUI89ABCDEFATL%ȻUHH=ySHHdH%(H$1^H=RH= FH=':H=c.H="H=H= H=H=H=ǧH=OH=sH=H=H=H=H=HLHPHL PHLPHH PHH$"PHPHPHPHPHPHPHPHPHPH[P1ۼHxL1L lH _I01234567HMLGRAPAQQRAQQAQAQAQAQQQQR茼HH,$L|$ H\$(D$fT$H5 1LVH$Ld$Ll$IHpLAGDHHуTL PHH9uLL1H<$H51OʈL$ϻL$H5v1ʃ費H<$Ld$H5ZLl$GD$$ƒDTD$!T$ ƒDTD$#1T$"LHH<$LLd$Ll$IHwAGHHуTL PHH9uLL1H$Ld$Ll$IHp LAGfHHуTL PHH9uLL1胺H$Ld$Ll$IHpLAGfHHуTL PHH9uLL1#H$Ld$H5ФLl$@D$"ƒDTD$!1T$ LٹH$Ld$H5Ll$@D$"ƒDTD$!1T$ L菹H$Ld$H5<Ll$@ D$"ƒDTD$!1T$ LEH$Ld$H5Ll$@ D$"ƒDTD$!1T$ LH$Ld$Ll$IHpLAGf.HHуTL PHH9uLL1蓸H<$HdLHdGLAAPA1e_LAXH5 1H|$8HH=HD$XCfo-H5Ƅ$$ƒ)l$`D`T`$!$ ƒD`T`$#1$"H荲Cfo5H5Ƅ$$ƒ)t$`D`T`$!C$ ƒD`T`$#1$"HHS1H5MHS1H5QHK@1H5,ʱCHfo=H52Ƅ$"ƒ)|$`D`T`$!1$ Hx1HKKH{Hfo-f$$HDŽ$ Ƅ$&)l$`HHƃ@D`t4`B@rH9uHH5Lu1L%L=ĘH=DkLCLfo H5BƄ$"ƒ)L$`D`T`$!1$ H舰D1LL1jL1HTH=>XDLLԹ1%L1HH=DLL1߯L1HFɯ ?H=CMfoH5[Ƅ$")T$`T`D`$ Hꈄ$!1aCOfopH5Ƅ$$ƒ)\$`D`T`$!CN$ ƒD`T`$#1$"Hfo%HsSHHDŽ$ Ƅ$()d$`HHуT`L `PHI9uH5BH1foHsWHHDŽ$ Ƅ$()D$`HHуT`L `PHI9uH5H1fo'Hs[HHDŽ$ Ƅ$()D$`HHуT`L `PHI9uH5ƸH1蟭H=ظDk\蟿foHs_HHDŽ$ Ƅ$()D$`HHуT`L `PHI9uHH51DLLz1L1HҸH=ϔD L L1赬L1H4蟬 H=z虾H=LDk`艾foHscHHDŽ$ Ƅ$()D$`HHуT`L `PHI9uHH51D1LLŸ1L1Hظ۫H=œ߽DLL۸1謫L1H薫 H=q落H}!foH$!Ƅ$@HHD$ H|$0)D$`f)$ )$0f.HHуT`L `PHH9uH5H1HD$ H|$0Ƅ$@foH)D$`f)$ )$0DHHуT`L `PHH9uHH5S1oH=qAʼnD$ efoaH5Ƅ$$ƒ)D$`D`T`$!$ ƒD`T`$#1$"H֩D1L1ALG販L1Hy蜩H\$H$@H$HLt$IHl$(LI@H=ZHqH#D$ MLH13ITL1H uH\$ Hl$(Lt$耹H=fo-H5Ƅ$"ƒ)l$`D`T`$!1$ H蟨fo5H5Ƅ$"ƒ)t$`D`T`$!1$ HJH=+DFfo=BH5Ƅ$"ƒ)|$`D`T`$!1$ HD1LL_1çL1Hz譧H=豹fo H5~Ƅ$")L$`D`$ HD`$!1GDLLJ1#L1Hb 胷H=H=AʼnD$ foH5BƄ$"ƒ)T$`D`T`$!1$ H舦D1L1ALdL1H[NH$H\$(HD$H$HD$H=L0DD#D$ HLIHD$L1HD$LH1ӥIuH\$( >H=·foH5Ƅ$"ƒ)\$`D`T`$!1$ H]fo%iH5Ƅ$"ƒ)d$`D`T`$!1$ HH=Dfo-H5YƄ$"ƒ)l$`D`T`$!1$ H蟤D1LL1聤L1Hشk H=FeH=D Q fo5MH5Ƅ$"ƒ)t$`D`T`$!1$ HDLL״11ΣL1H踣 .H=貵 fo=H5Ƅ$$ƒ)|$`D`T`$! $ ƒD`T`$#1$"H# fo /H5Ƅ$$ƒ)L$`D`T`$! $ ƒD`T`$#1$"H褢foH5aƄ$$ƒ)T$`D`T`$!$ ƒD`T`$#1$"H%fo=Ƅ$(HHDŽ$ H)\$`HHуT`L `PHI9uH5سH1蹡foƄ$(HHDŽ$ H)D$`fDHHуT`L `PHI9uH5H1GHD$ H|$0Ƅ$@foMH')D$`f)$ )$0DHHуT`L `PHH9uH5FH1ǠHD$ H|$0Ƅ$@foH7)D$`f)$ )$0DHHуT`L `PHH9uH5H1GH=D8DfoLƄ$(HHDŽ$ H;)D$`fHHуT`L `PHI9uHH5K1迟D1H5覟DHL%D$ HULD1~T$ H1H5vTD1H5]8D1H5]H=#=fo5H5@Ƅ$$ƒ)t$`D`T`$!<$ ƒD`T`$#1$"H蔞H=D>萰>fo=H5Ƅ$"ƒ)|$`D`T`$!1$ H+D1LL1 L1H mH=҅?fo-H5Ƅ$"ƒ)l$`D`T`$!1$ H茝@fo5H5Ƅ$"ƒ)t$`D`T`$!1$ H7H=DB3Cfo=/H5Ƅ$$ƒ)|$`D`T`$!B$ ƒD`T`$#1$"H褜D1LL}1膜L1Hp H=KjEfo fH5Ƅ$$ƒ)L$`D`T`$!D$ T`D`$"Hꈄ$#1ۛGfoH5Ƅ$$ƒ)T$`D`T`$!F$ ƒD`T`$#1$"H\HH=DL$ RIfoNH5Ƅ$$ƒ)\$`D`T`$!H$ ƒD`T`$#1$"HÚL$ 1LLӰ1褚L1H莚H=x蒬DLL1_1LHIH=3MDLL(1L1H@ yH=ށH=NDfo%H5>Ƅ$"ƒ)d$`D`T`$!1$ H脙D1LLhAտ1LLKL օLLH=D8fo-4H5Ƅ$"ƒ)l$`D`T`$!1$ HӘD1L6L跘Aտ1L5L蚘L %L蛪fo5H5HƄ$$ƒ)t$`D`T`$!$ ƒD`T`$#1$"H fo=$Ƅ$(HHDŽ$ H)|$`HHуT`L `PHI9uHH51蟗H=AʼnD$ 蕩 foH5Ƅ$$ƒ)D$`D`T`$!$ ƒD`T`$#1$"HD1L1AL_L1Hy̖H\$H$H$Lt$IHl$(LI@H=~H表H#D$ MLH1cITL1OHu H\$Hl$(Lt$谦H=~4H=uD   fo%H5uƄ$$ƒ)d$`D`T`$! $ ƒD`T`$#1$"H葕D1LL1sL1H] ӥH=8}WD H=ЁDl$ > fo-:H5Ƅ$"ƒ)l$`D`T`$!1$ HٔL$ 1LL1蹔L1Hȭ裔H=|触DLL[1tL1H^H=H|bDLL 1.L1H 莤H={H=D  fo5H5SƄ$"ƒ)t$`D`T`$!1$ H虓D1LL׮1{L1He ۣH=@{_fo=[H5ܮƄ$$ƒ)|$`D`T`$!$ D`T`$#1$"HВfo H5Ƅ$$ƒ)L$`D`T`$!$ ƒD`T`$#1$"HQH=JDMfoIH5}Ƅ$"ƒ)T$`D`T`$!1$ HD1LL1ʑL1H9贑 *H=y讣foH5cƄ$$ƒ)\$`D`T`$!$ T`D`$"Hꈄ$#1H=}D$ fo%!Ƅ$(HHDŽ$ H)d$`HHуT`L `PHI9uHH5)|1蝐Dt$ H5s}DHT@1zLl$8DE1ALDL1AL$1L1H$H\$H$Hl$LIfH=wHH#D$ MDLH1IL1诏HuHl$ H\$H=zw虡1@HHfoHD$ HH)D$`HH׃@T`|<`P@xH9uHH521E1Ll$`L%.|.H={L5*HGH={H={ߠ1H5{1Ƅ$貎fB; 1L蘎LB; H_CID`At Iu ߞAIu D$`H-ݼ豞H1"fH1H u ~H uLH={H$(dH+%(uOH8[]A\A]A^A_1LL覍ItLH5z1臍荚ff.fAWAVAUATUSHH $HH $HH $HxdH%(H$h71H$`IHߺD$Ƅ$_莒M|$H MLD14Ht$H$`@ H$hLd$ HD$ HD$(D$LD$00l$4HD$8D$@D$DD$HD$Lc H$h%LHD$ HD$(HD$00l$4HD$8HD$@D$HD$L - H$h51LHD$0HHD$@HHD$ HD$(D$8@l$2H1pAII!EHLDIHWMIE1=PAI!fE1= AI LLq=$fLH%LHHLHHc AHH cH EHDLHAHH EHELHHH&HDںLHHH'HDںLHAHHEHE^LHAHHEHEt&=t=IÌ@ADHI-fHt$LE1@ D$=q=X>E1=AI fILHLHmHLHHH%HDںKLHAHH EHE(LHHH&HDں LHHH'HDt;t!=t=IIHcIH H=SQ H~1I_@LHp<MIIċLHHLH<H3LHHAHc H؀ EHELHAHHEHELHAHHEHE蘙H t%=t=IÌ@@HIW@AVAUATUHH $HfdH%(H$1AH$HLD$ DHD$D$)$HH|$(HHyH|$D$(oHD$ HvH ;HD$0HD$HD$@Hc;HD$PHm;HD$hH}HD$xHD$H$HV;D$8D$HD$psDŽ$DŽ$H$脠Aąt-H$dH+%(HD]A\A]A^@1L$1RHt$HHt LNH|$LDt$H : AąH|$Ht$HuaH ZN 0H=|T_HTHl$EuH}PH}%[HV H|$E11DLAfDLLH=w`I|H)H5<\;D}^fDH M )H=`y^2fDH dM H=zA]^UAWAVAUATUSL$HH $L9uHHfH9dH%(H$8T1AH$@3HH$)$03L$)$0 )$0#)$0)$0HH$@ HDŽ$HH$@#HDŽ$HH$@HDŽ$HH$@HDŽ$HH$HHDŽ$HHvH|$HH$XH$H$H H=*;OffDH > H=N+A O8$<DŽ$HD$HH$L$D$(?xH$03HDSA[[AfDAvDH d= H=*A]NH$0SH|$P>7HHH߹ H)HD$pHPD$tPD$xPDL$|1DD$tL$p)1H I1L$0#L)LH$03>H|$HLHÅiH$L=< UHu;H=H|H)H5*;KL=D< H$0SH|$P66HHH߹ H(HD$pHPD$tPD$xPDL$|1DD$tL$p!0H I1L$0#L(LH$0 z=H|$HLH޺Ņ<H:L=|; H=cLAH=haL@c6A܋8Y9H=2; H&H1lIWH ; H=}( L5H=Q(GuL?AąH : "H=9kKDMD$HD$H>xH$03HE1ɹjDAYAZAH H: )AH=f?KjH #: )AH=eKEjD1H=9 Hj1H|$JH<$BLBH='FH=E'uF\0H 9 H=@gAJD$H m9 "H=tgJDD$|$DD$dJH<$ BLBDD$EDE1iH$HD$HD$hH=&=4E1AA&H=8 ID1HiE1FH$HD$HD$386LHwhIH=e8 1FH<$ ALA&H 78 H=hLt$Hl$D$(I|$h)Lt$Hl$D$Lt$Hl$H 7 1H=hHH$HD$HD$DZh`?H 7 <H=gAHH<$DD$LL$L$dL$LL$DD$H=27 1HjhmEH=7 A1H BiHkAE`AH#r H!EH|$HDDHDNAH<$XcA184HPfI1A84H=Y6 HC!H1DH<$DD$bDD$:1E1A8,4H=6 H H1?DH$HD$HD$BAWAVAUATUHH $HfdH%(H$1AH$HLD$pDHD$)$HH|$xHHY_H|$D$xoHD$pH\H #H$HD$H$H!DŽ$DŽ$H$zAąt3H$dH+%(HD]A\A]A^A_1)8Ht$HHYHt$HkHt$L$Ht L4H|$H "LAąLd$A$A|$HT$ ~|$ I6IHHD$`f)D$@)D$ )D$0)D$PD$ HD$8A$D|$DD|$HD$P -A|$1Ht$ ;AĉYdELX(S<1H5=d((S@1H5^d(SA1H5d'SE1H5d'HSI1H5d'HkQ1H5d'H1HH5e'HkY1H5(e'H1HH5Cef'Hka1H5deL'H1HH5e2'Si1H5e'Sj1H5e'HSk1H5e&Ss1H5f&SwH1[H5%f]&f.USH(oG dH%(HD$1HG)$HD$HtOHHH*HHF^HGH*5H5tHHh'HD$dH+%(u:H([]ÐHHe*H52HH]HGH1& 3fH5ATAfHUH DHdH%(H$1H|$LD$`HDŽ$)D$`)D$p)$)$6|Aąt/H$dH+%(HĸD]A\f.1-Ht$HHHt$HfH$ri0H =* H=WA6;H0Hl$EuH}p,H}7H2;f.HD$)D$HD$PD$)D$ )D$0)D$@xHt$11H= _Aą~!H=3dt H=cH^HEH5j) e1DZ2}h:LH/Hl$Et*uH}+H}(6HA1V}:H=( AO1H }H]$70DATAfHUH DHdH%(H$1H|$LD$`HDŽ$)D$`)D$p)$)$yAąt/H$dH+%(HD]A\f.1+Ht$HHHt$H4fH$ri0H ' H=UA8Hn.Hl$EuH}*H}4H_0;f.H$1)D$0H)D$H1)D$ HD$PD$HT$()D$@D$P0ufGH/ HD$4HD$GfxHt$1O/AątDW%T$T1H5>!|$TD$THHcH>}7 H=f[3|$Tu$ffH5H*$Y%H*ȸ^!EDH=<H=1aH=`|@H=0lH=6`H,Hl$Et*uH}>(H}2HA.c}6H=% A1H HZ3lB-fATUSH$6{H+H5HH'!;+H5HH!{*H5ߜHH {*H5؜HH Lc A*H5`HH LH*H5HH {(u*H5HH {0[*H5HHi {8A*H5Z`HHO {<'*H5p`HH5 {@ *H5_HH {A)H5^HH {E)H5_HH{I)H5HHLcQA)H5`HHLH)H5#HHLcYAb)H5_HHpLHD)H5`HHRLcaA%)H5`HH3LH)H5 `HH{i(H5HH{j(H5vHH{k(H5!HH{s(H5XHH{w(HH5UHH3H5_UH1M -[H]A\/AVAUAATUSH`T$ dH%(HD$X1>Dw-HHTDd$ A1H|$HDd$AWAHAVDAUATUSHdH%(H$HiH$L$HD$1HH0H|$Ƅ$oH$H0H 1KH$ HD$H$0H5DŽ$(DŽ$8H$@rZAąt3H$dH+%(_HĸD[]A\A]A^A_1! Ht$HIH%H\$LLt$H1Ht$ LZAą HH{HT$ |$AH= A1H H5<@A8H=Y HCH1ff.AWAHAVDAUATUSHxdH%(H$hHx`H$L$HD$ 1HH'H|$(Ƅ$oH$H'H FH$HD$ H$H],DŽ$DŽ$H$PAąt3H$hdH+%(vHxD[]A\A]A^A_1Ht$(HHD$_H&H\$(H|$Lt$ H譝Ht$LQAą^HH{HT$0|$LHHD$PHHD$X1HD$0HD$8Hl$@D$H@HD$`fD$hH5tLA sE1H5݊ft bf8HHuD$i}E1H\$pIL=FH5 }LH}eH5FLHs}JH5|LHX}/H5|LH=}H5|LH"}H5|LH}H5|LH}H5|LHfHDŽ$)D$p)$@EL(H1FB|-IgHLHyIuL$?LH5lHMf(1LLLH x)$)$HDŽ$LLH5{HLm H5.H1 LE H}1DH= EHyH1 ^fH EH=D H;H=d D1HD H|$Hl$(EtPuH}H}1H@0H  H=(A } fDH "H=< KfDH= HAAHZDH=A1L50C;U1H5ryU1H5AU1H5BU1H5BU1H5%BU 1H5.BU 1H5?BU1H5PBsLL1HVHuH5x1HL(H5Ot1L5fDL1HI9u cHfDH -H=H@L%L5 H H=;I\$ @A $IH= 1LL9uH H=T;HLy f H=V L1HL9uH57 AHAH= A61H ɄH,8)A8H= HH1<AWAHAVDAUATUSHxdH%(H$hHWH$L$HD$ 1HHH|$(Ƅ$oH$HqH @H$HD$ H$H#DŽ$DŽ$H$bHADžt3H$hdH+%(6HxD[]A\A]A^A_1Ht$(HIўH'VH\$(LLl$ H!Ht$LHADžaHHm{HT$0|$LHHD$PHHD$X1HD$0HD$8Hl$@D$H@HD$`fD$hyH5]lLAOE1/H5!ftfD8HHuD$} }H]Ll$pIH5*uLHfE1f}HDŽ$)D$p)$tQD(L1H ?DD$ hHH\LLHDD$ EAA9|L$XLH5dHff(1LLLH q)$)$HDŽ$LLH56sHLH5&H1 6L^HF@H JH=>HH= D1H?LFHl$(EuH}H}H7f1DfH=O EHyqH10H $ H= Aj}fDH "H=5fDH= H<AHrDH==1LmVU1H5=L55=(f}t$LL1IE9|H5fq1HLH5l1L-L1HL9u H(fDH -H=;L52~L-[H I^H=14/ DAIH=Y 1LL9uH > H=4HL*f. H= L1HCI9uH5 AHAH= A|1H I}H%eYA8H=r H\H1AWAHAVDAUATUSH(dH%(H$HPH$L$HD$`1HH/H|$hƄ$oH$H!H ;H$HD$`H$H}DŽ$DŽ$H$AAąt3H$dH+%( H(D[]A\A]A^A_1Ht$hHI聗 Hl$hLLl$`Hэ Ht$\LHqH5mHHAFD110bFD111bFD000bFD001bFD010bFD011bFD100bFD101bFHINVALIDHff.@AVAAUAATIUSHPdH%(HD$H1HHD$H1HHH$HD$ 1HD$D$@Dt$D$(Dl$,D$0fD$4D$6\$7fT$8u,1ҹeH5_ D 8u3HHuI,$HT$HdH+%(/HP[]A\A]A^@H 0H=$L5"_L-H I^H=ae DAIH= 1LI9uH n H=5HLZf. H=6 L1HsL9uH5 8H= HںH1*ff.fATAHUDHdH%(H$H0H|$8LD$0D$(HD$ 1HHH|$D$8oHD$0HH #HD$@HD$ HD$PHHD$`H*HD$xHH$HD$(H$HHD$HD$XƄ$nDŽ$DŽ$H$G Aąt(H$dH+%(HD]A\1Ht$HHvHD$Dd$(HD$?xHt$D1WH|$ H5DAEtn/H  H="AH|$HtHHl$EtPuH}BH}H@H|$ Ht$ Aąxbt$ H|$f}fDD8H0H d H=A]TH=9 H ZH 1oH= A1H ZHC@AWAfAVHDAUATUSHdH%(H$1H"-H$D$HHD$@1L$HHH|$8Ƅ$oH$HH H$HD$@H$HH$H(H$HH$(HD$HH$8HEDŽ$DŽ$Ƅ$ nDŽ$0DŽ$@H$H)$)$)$)$Aąt5H$dH+%(EHD[]A\A]A^A_f1Ht$8HHsH(HD$8Dd$HDExH$Dd$|E1Ld$PHD$`LHHD$PHD$XD$h@|$lHD$pD$xHDŽ$fD$d~ZA] fH8Hl$8Et|uH}H}uH-k8MXHHK fDH= 1AWrf}fDH$H$XH$$H9uHD$8L$HHD$P0=x1L<$,$CXsH|$PHOHDɉ$$HHH9uHGfH$$H9uHt!|$ |$<$,$l$l$ f|$ Ld$@H5?L|$<$/,$l$l$ |$ LHt$4|$<$,$Al$l$ zH UHTD$4|$ L$HJ|$<$ ,$HHIL l$01L$<$l$HH Ll$01<$H LvH5oLHL\LH5zHLH5iH1W L0H t H= Am|$H5{H|$<$l$1H5l$ <$XZ{H MTHH1Ld$@l$ l$,$H= H SH)1H= AM 1H SHk:H=S] |$ $ $l$@ATUSHH=GH{H31H H YH5H1H{Hs1H H [YH5H1uS 1H5^HS 1H5f1DHS(1H5-HS01H5+=HSTH5J1HS\1H5d߿HSl1H5ȿHSt1H5豿HS|1H5蚿HSd1H5胿H5 1iHH5#1f1LH5.12H1H5Bf1HH51H5< 1ؾHH5Z 1f1軾HH1H H nWH5_ H1舾HH1H H 2WH5 H1L.1,D2D0H5"E1E111H5%"1[ ]A\pH=DH51HL%,谽HH5 1薽HH1H H IVH5 H1c H5 1JH5E 11H5l 1HH5 1H$H5 1.1,D2D0H5 購E1E111H5 1薼4H5C1}8H5C1d1H5 HCH5C10UL1HH9u [ ]A\|@HH521޻H5H1ĻHH5V1誻H5d1萻HH1H H CTH5dH1]HH51CH51)H51HH51HH51ۺfDHS8H51蹺HS@1H5/袺HSH1H5`苺SP1H5tbff.@AVAUL-rATAUSHH`dH%(HD$X1.H{H31HH H RH11LIHLH5iH H{Hs1H H RH11LIHhLH5FHƺ{ H5AHH諺H{ f1H5AHH荺H{(H5AHHrH{0H5 AHHWAMH{lH5FAHH2H{TyH5IAHHH{t^H5LAHHH{\CH5OAHHH{|(H5RAHHƹH{d H5UAHH諹H5UAHH荹Hf1H5RAHHlH5KAHHNHf1H5FAHH-A{HgH5AHHIH5AHHHf1(H5AHHƸHH1H H YPHQ11LIHLH5AH}AHH1H H PH1L1IHLH5H*2fIHD$ )$(LD.)D$D,L5YpP0LP1能LLxH5uAHH趷fE1E1)$(1)D$LLHD$ jj/LL$H59AHHbAHH5'H1 HHD$XdH+%(H`[]A\A]A^fH{8GH5=HHH{@,H5=HHʶH{HH5=HH诶{PH5=HH蔶B4Ld$0H5S@HHf8H5D@HHIHH58@H+f(1LLLHD$P)D$0H 6)D$@蛻LH5?HHѵt@ H5>HH誵HHH5>H茵HH1H H MH11LIHLH5HC H5>HH&kH5>HH NH5>HHH0H5u>HHδH$H5sHH谴HH5<HH芴H5<HHlHH5<HHNHH5<H0HH1H H KH11LIHLH5g<HH+H5a<HHɳ H5T<HH諳H5M<HH荳HѿH5I<HHoH賿H5@<HHQG7AUf10xATL-IUHnSH_HfFFfDHLH1蓸HHHHL9uH[]A\A]ATHdH%(HD$1HH$!t-H<$D'qHD$dH+%(uBHDA\H=y AH |BHAH<$f.AWA6HAVH5.AUATUSH HdH%(H$1H{H$D$@HD$HHSL$HD$X1HH$ HH-HL$@H$8HH$HVH|$8H$HL$HH$HHs;H$hH5H$H$XHL$PH$HQ;H$D$PD$`Ƅ$iDŽ$DŽ$Ƅ$@oDŽ$PDŽ$`Ƅ$lDŽ$H$H5)ZH$HL$XH$H5H$ HD$`H$HH$H H$DH$0H2.DŽ$Ƅ$pDŽ$DŽ$H$Ƅ$nDŽ$(DŽ$8H$@Aąt1H$dH+%(K#HĸD[]A\A]A^A_D1AHD$PaA<L$H|$XL4t^1L1H)==HH9t=uHH9uHt$8HL$ HT$$HMHt$8HAB[Iǩ D$$Lt$H-P' D$`HD$HD$8HHD$\QHt$4LAąqHt$HL$0HT$,HML$,P 0'w:&HHHuHHH= HW1SAH= D1HU0AD$$-P'Ll$8Lt$HHLLt$QP Ht$4LAąLHX"LH~Aă&HL$0HT$,LHKD$,=# # A_'蓳IH`)EUE(A}E1H$H$HT$pHHD$pHD$xL$DŽ$@H$HDŽ$fD$H|$H5&A諻EsD$4mLDAt YAuCH軶Hl$8EuH}]H}H謸tH\$8HLt$HHfNHt$4LAą-HHVIH&w%{HHT$p$H$HH$1HD$pHD$xL$DŽ$@HDŽ$f$葮H5u%LA} E D$4$Lq@=>6D)}舿E1HL$XH=D 11HYf.:H  H=A 0H H=AݾLl$8D$@HLt$HLD$RLHt$4LAą D$<@IHS%Au0#A}1HT$pHH$H@L$LL$$f$HD$pHD$xDŽ$@H$HDŽ$}H5a#LA LL$3 E A Mq1fDAVMt9CA>7uT$A:VuڋD$4LL$ A~IH5B4LH A~ H5:4LHIFLL$H`fH*fIF f.d$zf(tHfH*^,LL$yH53LH臧A~^H53LHlIFIVLL$HvHfH*HfH*^ 9Yuf/H,H^fH*f/H,LL$L$輰H5%LHʦA~衰H573LH详IFLL$L$HfH*t$IFf.zf(tHfH*^,LL$L$.H52LH=#vADt A 7kIH8A}xA}H1$H$HH$HD$pf$H¾HD$pHD$xL$DŽ$@HDŽ$HD$H|$H5A~EFL$4 H= H1A8L谪=$b,H H=xA赲LmH= D1H}ЯhD3LL$H b "H=y\DvH=6 L1HD'pH  "H=+H "H= ,H ˠ H=AıL|dH "H=蚱@A}I4H5LHBA}H5+*LH'A} H5(*LH A}H5dLHA}ȥH5qLH֛A}譥H5)LH軛A}蒥H5)LH蠛A} wH5PLH腛A}$\H5)LHjA}(AH5:LHOA},&H5GLH4A}0 H5\LHA}4H5sOLHA}8դH5d)LHA}<躤H5b)LHȚA}@蟤H5 LH譚A}D脤H5I)LH蒚A}LiH5LHwA}PNH5()LH\A}X3H5")LHAA}`H5LH&A}dLH5H L莮H5H1Ș >LfL辦H=B 譪AU1H5S 膘AU1H5l oAU 1H5} XAU1H5 AAU1H5 *AU1H5 AU1H5 AU 1H5" AU$1H5; ΗAU(1H5\ 跗AU,1H5} 蠗AU01H5 艗AU41H5 rAU81H5 [AU<1H5 DAU@1H5-IUD1H53AUL1H5TIUP1H5eIUX1H5іAU`1H5躖AUd1H5裖L諤T$4H|$sAT$4Et$H|$sADEfT$H|$ yAD)H ] /H=WH|$pH6A,DD茝IHYEMEH=( LPuL舣LklLsvH=LL$]IV1H5 6IV 1H5,IFLL$Hj fH*fIF f.\$zf(tH fH*^LL$H5蹔IV1H5袔IFIVLL$HoHp fH*H fH*^ T(Ydcf/U H,HU fH*f/H,H51LL$L$IV1H5IFLL$L$HfH*l$IFf.zf(tH fH*^¿LL$H5L$聓IV$1H5jIFIV$fLL$L$HtQH fH*H fH*^Y.bf/i H,H= fH*f/H,H51LL$L$ВIV,1H5蹒IV41H5袒IF,LL$L$HHfH*t$IF4f.zf(tHfH*^¿LL$H5L$4IV<1H5IF,IVȤA>ILuIA~貙H5>LHA~蔙H5>LH袏A~  IF H51]LH5LH1: 谞LؠL03A>LuaI1H52IH=\INAV1H5EL!A~ IF H5!1蛍L裛A(A$\H,H?y\H,H?\H,H?U\H,H? \H,H? !f\H,H?\H,H?;\H,H?\H,H? f\H,H?HƒfHH H*XtHƒfHH H*XHƒfHH H*XHƒfHH H*XHƒfHH H*X8HƒfHH H*X HƒfHH H*XHƒfHH H*X^AHƒfHH H*XHƒfHH H*XrHƒfHH H*XH } (H=AsHƒfHH H*XF\H,H?!HƒfHH H*XHуfHH H*XHƒfHH H*XHƒfHH H*XH )H=A褠HƒfHH H*XYHƒfHH H*XHуfHH H*X{\H,H?HƒfHH H*X\HƒfHH H*XMHƒfHH H*XbH (H=XA跟_HƒfHH H*X\H,H?HƒfHH H*XHуfHH H*XhHƒfHH H*XC\H,H?HƒfHH H*XHуfHH H*XHƒfHH H*X\H,H?hHƒfHH H*X'HуfHH H*XHƒfHH H*X\H,H?HƒfHH H*XoHуfHH H*X?HƒfHH H*X\H,H?HƒfHH H*XHуfHH H*XHƒfHH H*XHƒfHH H*X#HƒfHH H*X\HƒfHH H*XHƒfHH H*X\H,H?HƒfHH H*XPHуfHH H*X HƒfHH H*X\H,H?iHƒfHH H*X0HуfHH H*XHƒfHH H*X\H,H?HƒfHH H*XtHуfHH H*XDH= H H1YA~RH5LH`A~4H5LHBA~$IFINAV1H5L!A~RIF*HD$H= 1AuH H?LL$H=ۉ A1H H ]H= D1HAJH=V$}HT$|$,HHD$0HHD$81HD$HD$Ll$ D$(@HD$@fD$HgH5KLAEH= H< I3I3H E}E"D$-P'HLe2DD$ T$LA9AFljzA:fDDȰEk=H  H=?AL褈HD$XdH+%(H`D]A\A]A^A_H  "H=蛐f%H t H=Am|1fH 9 H= 3BfDA9DH= H Hc1A1H=~ A"1H HvyA8|H=~ HyiH1Ɍ@AWAHAVDAUATUSHdH%(H$HH|$hLD$`HD$1HHUH|$D$hoHD$`HMH HD$pHD$H$HD$xDŽ$H$DAąt-H$dH+%(jHD[]A\A]A^A_Ð1Ht$HH%  u>HHl$EtjuH}H}CHifDHT$Ht$H^ÅtH=} پ1HaA9}fDHt$HLt$Ll$t=t=uGLLHvf0H t| H= AmLHHt$ L`ÅBLHf#~IHAUA}HT$ |$DH H H H Hi HE H! HHHHHmHIH%HHHHHqHMH)H HHHHHHQH)HgHH>HHHAWAfHAVH DAUATUSHhdH%(HD$X1H|$LD$HD$P)D$)D$ )D$0)D$@^AŅt'HD$XdH+%(HhD[]A\A]A^A_Ð1L%@H zHt$MHI8Ht$LH5HHD$H1q@LH5HEӿ1pLH5HEӿ1pLH5HEӿ1pLH5HEӿ1pH=蟂H5HHLE1LhpL1H5MOpLHHH5HE1(pLH5HEӿ1pLH5HEӿ1oLH5HEӿ1o@LH5HEӿ1o H5LE1Lo@LH5HEӿ1lo@LH5HEӿ1NoŀLH5&HEӿ1.oLHHH5"HE1o@ LH51HEӿ1n@@LH5;HEӿ1nLH5CHEӿ1n LH5KHEӿ1n@LH5SHEӿ1knLH5[HEӿ1KnLH5cHEӿ1+nLH5kHEӿ1 nLH5sHEӿ1mLH5{HEӿ1m LH5HEӿ1mLH5HEӿ1mLH5HEӿ1kmLH HH5HE1DmLH@HH5HE1mLHHH5HE1lL1H5l@LH5HEӿ1lLH5HEӿ1lLH5HEӿ1lLHHH5HE1YlLHHH5HE12lH=6~LxHl$Et*uH}sH}K~HzWfD}@xfATAfHUH DHhdH%(HD$X1H|$LD$HD$P)D$)D$ )D$0)D$@5Aąt&HD$XdH+%(HhD]A\1sHt$HH!Ht$HtMH=!}HvHl$EtMuH}rH}6}HxkfH p 0H=렐}wATAHUDHdH%(H$1H|$hLD$`H$HHLH|$D$hsHD$`HAH DHD$pHH$HID$xDŽ$H$Aąt*H$dH+%(fHD]A\D1yrHt$HH Ht$H,H$HD$fHD$P)D$@)D$T$DD$)D$ )D$0D$@xHt$1vAątpD@H(uHl$EttuH}pH}e{Hw0H 4n H=A-H$H51ht@}H=m A&1H EHɢ|"uATAHUH5HHdH%(H$8HH|$hLD$`HD$1HHL$HD$hnHMUH$H OHD$`HHD$pH$HD$ H$DH$H VH$HD$xDŽ$Ƅ$oDŽ$DŽ$H$9AąD$ Pv F1pH4$HH3 H4$H0H `l H= AY}DHrH,$EuH}nH}#yHtH$8dH+%(.HHD]A\fDT$fH$HD$P)D$T$T$ )D$0D$T$8)D$ )D$@xHt$1sAą9L$ T$1H5'ff}x|@H Lk ,H=F|H,$Et*uH}mH}$xHAs}|H=j A&1H BHҟ y-rATUHH $HdH%(H$H AH|$XHLD$PDHD$1HHH|$D$XoHD$PHH @HD$`HD$HD$pH:D$hD$xH$蕻t1,eD H$dH+%(DHD]A\@H|$Ht$ AąxsHD$@D$4H|$ HH$HD$ Hl$(D$00HD$8HD$@D$HD$LeAąt`~>Hl$Et;uH}kH}DvHqH=4mf}(zfD|$ HtHHtHH=h A1H =HwypfAWAVAUATUSHH $HH $HXdH%(H$H!AH|$hHLD$`DHD$1HH4PHD$hnHD$`HH HD$pHD$H$HYH$HgH$HD$ H$HsD$xDŽ$Ƅ$bH$-AąH$\$x1Lt$|$,fT$HLHH$@HD$HD$Hl$ D$(@HD$0D$8\$H)1HHH\$(HHD$fHD$P)D$0H$D$D$08$D$)D$@$HD$HD$ HD$@H|$ D$4D$PD$TD$V]AąPH5|1H$H51H$H51H$H51H$H51H$H51qH$H51VH$H51;H$H51 H$H51H$H51GH$dH+%(HĐD[]A\@1XH=L EHH1'[DH=dQ똺0H L H=bzA]pH=L A/1H D"HuZ4T@ATIUSHdH%(HD$1KH5HqKHtdH=HHjWHTuDH= Ht$+uO|$uH H HHt LfDHD$dH+%(u#H1[]A\Dv H `SAWH L HAVLH 6AUHH5OATUHPHMPHxGP1EH1H H5GRIIHRREH 1sNHHINIHL{SHHHGHIHuEDLH KIHt-L=tLD$ =QD$ H]A\A]A^A_HEIHtSL0TIHu.fDLLSIHtLtLHLIHuHLKHH/LL3OIH1GH I H= ZDH]A\A]A^A_ff.ATAH6UH5fH8dH%(H$(1H|$pHl$HD$ )D$LD$pHH$HL$H5VH$H5vH1H$H H=H$H5rH$HL$H$H5H$ H ^HD$pHvH$0H5qH$HHL$H$H$hH DH$xH|$H$DD$xnDŽ$H$DŽ$Ƅ$sDŽ$DŽ$Ƅ$rƄ$PaƄ$tH$HD$ H$HCDŽ$DŽ$H$`8HD$L$u$sxHEAHD$EHT$D$H8HD$8HT$0HD$@@D$LD$ H|$0HD$XD$PD$D$TD$D$`D$D$a;CAąt\wHl$EtquH}IH}THOH$(dH+%(H8D]A\DL$HT$1H5|AHl$Eu}WfDAD fDH=s$KRH=xF A 1H HZ{TH=GF A1H H){wT_MATA$HUH5dfHdH%(H$1H|$`Hl$)D$LD$`HH-HL$H$HD$`H5RH|$HXsH$H GHD$pH$H53sH$H dnH$HD$H$DH$H H$HnD$hnD$xH$DŽ$Ƅ$lDŽ$DŽ$Ƅ$tDŽ$DŽ$H$ E-HD$L$u$hxHBAHD$E HT$D$88HD$(HT$ HD$0@D$Hl$Eu}TfD>D fDH=pHRH=hC A1H HJxQH=7C A1H HxgQjJAWAHAVDAUATUSHdH%(H$1HFH|$hD$HD$1LD$`HHiH|$D$HD$`HiH mHD$pHD$H$H/oD$hoD$xDŽ$H$“Aąt3H$dH+%(EHD[]A\A]A^A_1qEHt$HH1u|0H A H=oARH=A D1HOHTHHl$EuH}CH}NHEJ5Ht$HL$HT$H|$7PLt$Ld$)CIHDA$A|$L|$ HHD$ HD$@LHHD$H1HD$(Ll$0D$8@|$ "H=OfDxH|$ @H=lKI}Iu1H H H5H1/9I}Iu1H H H5H19I] 1H5H8Hڿ1H58IU(1H58IU01H5%8AU8H5<18AU@H5T1p8AUDH5d1X8AUHH5|1@8IUI1H5)8IUQ1H58IUY1H57IUa1H57I]i1H5H7Hڿ1H57I]q1H5H7Hڿ1H5|7AUyH5(1d7AH551I7IH5;1/7AH5H17II1H H H5@H16AH5J16A1H5]6AH5d16IH5r1v6IH5T1\6IH5^1H;6Hڿ1H5j%6II1H H H5H15AH5[15AH5h15IH515II1H H UH5FH¿1o5AH51T5gH=JLGI}Iu1H H H5H15I}Iu1H H H5H14AU 1H5 4AU$1H54AU(1H54IU,1H5+4IU41H5o4IULH 4I}IP@H5LH3I}Q5@H5LH3I}Y@H5LH3I}a?H5LH3I]iH?H5LH{3H?H5?LHa3I]qH?H56LH?3H?H5:LH%3A}yk?H5:LH 3AL?H5aLH2I.?H5LH2A?H59LH2II1H H @H8@11LHHAHH5Ld2A>H5LHE2A>H5oLH&2Ai>H5LH2IK>H5 LH1I->H5LH1IH>H5iLH1H=H5LH1II1H H H?11LHH?HH5LC1A=H5ԤLH$1Ag=H5LH1II=H5LH0II1H H zHr>11LHH@?HH5pL0ALH5#L/I}Iu1H H H=11HIH]>LH5L/A} HH5`1( X9L;_H . "H=p>:fD}>V(8+H=- HH1;fH=- 1H;H=<:HH51(HSH531'HSH5T1'HSH5u1'HS H51'HS(H51'HS0H51'HS8H51u'HS@H51^'HSHH5;1G'HSPH5\10'HSXH5}1'HS`H51'HShH51&HSpH51&HSxH51&L+H=X3HVTff.@AWAVAUATUSHH $HfdH%(H$1HAHHD$(H$1DHHRH|$8HD$0H$HRL$H$HD$(H RH$HWHDŽ$Ƅ$D$ D$Ƅ$oDŽ$DŽ$H$ )$)$)$+|ADžt4H$dH+%( HĘD[]A\A]A^A_H|$(Ht$$|H HADžFHD$8DEc @Ll$@D$TH$HLHT$HHD$@D$P0HD$XHD$`D$hD$l%ADž1>-Ht$8HHnHt$8HIĩHt$8HL$HT$ HÅD$ =Pe=R'J=O'HD$8xHE1E11j1ҾjjjAUjjjjh jjj 8Hp\$@HHH#)D$$?L$L$E19fDLDL$H Iĺ1)$DŽ$*L 2H5LHH$|$D0H5LH-$L8H5ZH1" `3L5~H HH=' 1?6Hl$8EtjuH}E*H}4H04H ' H=A8DMXH5.Hl$8Eu}8=#'w!=&HHf0H 4' H=TA-8=a'u@=7PHD$80kxLl$0LH|$0/HD$0AnHD$8x1ҹLTH|$04D,D.D8D$*/D$$7H$I+H56LH!|$+LH5H!EEH GH1o'Hg/H5LH!D}+LH5H!L6H5ZXH1H 0LE12fD=$w1=#/@ =Pf.=$HD$8fHDŽ$)D$@)D$pD$@)D$P)D$`8D$p"2x1L(-h$fA*D$$A D$L$E1L5D$LY^IžH %L-H5LH# DL$)H5LH )LH$7L-H5LHLP4H5VH1 /L(1H=&bPH=$,JP>H= t,2PAD$D$$D$*A߃3EEH$IH !H1L$$H,LH5H)LH$LO,LH5{HL3H5\UH1J -L/H=i" A1H HA0H HH=/" 1Am0AAԿAH5ӺH$1H5ԺBH `HH5E1pT$D1H5YYtH5ԹE13D1H5˹H$1H5̹H51E1T$1H5DDH51D1H5?H= A,1H NHU.on(H=',MMfDAWAVAUATUSHH $HdH%(H$HŀAH|$hHLD$`DHD$1HHYGH|$D$hoHD$`HQGH QHD$pHD$H$HLD$xDŽ$H$HqAąt1H$dH+%(&HD[]A\A]A^A_D1"H|$Ht$ HqAą<Ht$HHt$H 7HD$8UPH$Ll$ HD$ HD$(LHD$00T$4HD$8HD$@D$HD$LAąNHD$0x1L|$HaJ#iH=BAWAIH5AVIfAUEATULSH˹-HdH%(H$1HT$ L|$()D$ H$L$HD$0HH$H|$H !H5dBH$HH$H H5H$H2BH$HT$,H$H H$H5E=H$H$0LH$@HH$XDƄ$nDŽ$L$DŽ$Ƅ$sDŽ$DŽ$Ƅ$aƄ$`tH$hHD$0H$xHPDŽ$pDŽ$H$ eAąt2H$dH+%(HD[]A\A]A^A_fDMH H|$H1rAąHD$t$(u$xL5AHD$E,HT$ HD$PD$X8HT$@HT$ HT$H @D$\D$0H|$@Dl$hD$`D$(D$lD$dD$,D$qD$pAąuz1AuD$ T$(DH5RPDL$<1LD$0HT$  XZH|$ Hl$EtFuH}H}(H~.BH|$Hl$Eu}#HpfDH=>\H= A1H dHFH=B8>d<ff.AL«f.ALf.ALf.ALf.AUAHHATH53fUHdH%(H$1H|$pHl$ HD$(HqD$LD$pHD$1HH7HL$H$HD$pH7H56H$HD$H=H$H7IH$H H$H5=H$H=H$H5H$ HL$$H$H$0H=H$HH5D$xoDŽ$DŽ$Ƅ$nDŽ$H$DŽ$Ƅ$sDŽ$DŽ$(Ƅ$PzH$hH H$xHL$%H$H H$XH$H=?H$H$H5ٳH$HL$&H$0HD$(H$H dH$H|$H$ DH$@HDŽ$`DŽ$pƄ$SDŽ$DŽ$Ƅ$pƄ$(lDŽ$8DŽ$HH$P_t5` D H$dH+%(THD]A\A]fDH|$Ht$1`Aąt$ u%HD$xH Aąil$$t$(@E1HD$Ll$@HD$8HD$0HD$D$H8]@D$LD$ H|$0D$PD$TD$(l$XD$\D$%fD$`D$&D$bAą~x=LHl$EtuuH}wH}HnIH&H=cA`fDH=L~}fDT$$DD$ 1H5MHL$.@fH=9.3H < H=A5H= A1H zH@Il$$pH=S8ff.fHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IЉHD$IHD$ H$D$0HD$\HT$dH+%(uHff.@AWAVAUATUSL$HH $L9uH8fdH%(H$(@1AH$ HL$0DHDŽ$)$ HH$8HHH$Ƅ$8dH$0HH H$@H$H$PHkDŽ$HDŽ$XH$`z[D$ L$H|$fH$-HH$ HDŽ$H|$hHH$ DŽ$>H|$xHH$ HDŽ$=H|$pHH$@Ƅ$=H$HH)$H)$)$>EEnAG$HH$H$HH$HDŽ$H$DŽ$0HDŽ$DŽ$Ƅ$Aą1H$-H$-DHH9t8 tL$>H:1HL$=LHھ LH$.1lMLH= H1H$H$ ?1H H|$8HHH$H߾P$P$P$1D$D$\H LH$=HHD$(H16HH$=1ft t Hc4=HH9uH$=HcL1 HƄ =HDŽ$=Ƅ$=HH$=f.t tIcA =HH9uMcHIپH Hġ1BƄ$=t$8H\$xLD$8HOAYAZHD$XH}ILOWHHH|$H$H1 H|$ HL$H= H+1L$1LHEEAGH<$$HHDŽ$L$DŽ$0H$HDŽ$DŽ$Ƅ$D$<fH$L HD$@HH1t$0L6VHt$0HL$ ^H5e_H IHtLHLO 1HHAAGH<$$HHDŽ$H$DŽ$0HDŽ$H$DŽ$Ƅ$ t$0L Ÿ1LQUt$0HH\$PHL$ HXH5-dZH IHtHHL] E7HEAH$E1HH$HHDŽ$HDŽ$H$DŽ$@$ H$HDŽ$ fD$( H= H1+HH$ @1HHEEAH$E1HH$HHDŽ$HDŽ$H$DŽ$@$ H$HDŽ$ fD$(H=! Hz1^H$ @1HHA7AHH$1ɾH$Hf$(HDŽ$HDŽ$H$DŽ$@$ H$HDŽ$   H=_ H1L5' @IEfLLE^HAAH$1HDŽ$HDŽ$H$DŽ$@$ DŽ$D$$DŽ$HDŽ$ f$(7AL ANH=q H*1HI" H_ L9LL- H$=IILt$@.AMH= H1BITL9EMAtA@AWH<$H$H$H$DŽ$0$L$HDŽ$DŽ$D$Ƅ$TAIAEt$0Lt$0L LLPAUHHPHL$01aH H5x_LHHHHD$ITH|$L9H$LDŽ$HHD$HDŽ$AŅF $t$ L $1ɺI1LI评AŅD$ht-1ЍJAA f9uމL,@ILLDŽ$tHT$HLH$H$$DŽ$Aą% $$LL$H11ILIȃAą A L|$AE1E1CD$AfLDE11oPHRHP HH$oS@(H{ C*HS CfD{.IfC(H t t Hc3HH9uHc f{ t_DT$jDT$HٿcHH5Et!~HHL LFLF9tڹ@8t K,AAA9s E9LL|$EAEH$H@HHHD0HD$P6f.H= H1HH0 H9l$PvLe"MtL>Du DŽ$HD$DŽ$HC H$L6 $\$H\$ I9vHD$ D$D$H$E1Hl$H$@H\$ D+l$L9$HI9sD$HD$HIHDLLtH$AHH= E1ATH HDD$(AZA[DD$H=} H1HH|$H0)H9l$PH$t$0H1t$0L aLyKH|$PHL$ NLDŽ$DŽ$DŽ$XZH4$/ HT$HLAD$A$D9FA9ʼn‰DAFՉT$1T$ $?$IċD$$MZ <$g$L$1ۃD$LAHA\$D;4$.AAD9t$u D$ $D11IML*tEH= A$L-H 1LD$LHKH= 1LPD$H=u D1HHL$H|$x1LrH{HL$XHHL{IPHD1APLL$xH$LH5,AHHH S f.IDI@tkNMtIHsL$HLIH5jLHKH<$H5"xLH0LH5H >S @AH +S fIAFItoNMtIWHsL$LIH5 jLHH<$]H5wLHLHH R LwE1H R DAA@t~AFLMtIGLsL$A~@I{H5miLHH<$H5vLHLHH R f.H\$H^H5 H1 H6H= H Hl1AA6I~i`H=} I1H HJH=( ]@ATUSHH $HH $H@dH%(H$8 1I|$HD$0Lt$$H$HD$D$0HD$D$ D$(D$,ZH$0Ll$HD$HH$D$0HD$D$ \$$D$(D$,GuhT$JЃ0 HH8H$8 dH+%(uDH@ []A\ffH=9H=2rqDAVAHQAUH5lfATUHdH%(H$1H$Hl$HD$0)D$L$)D$ HH$HL$H5*H$H5H0H$H5aH=H$HL$H$H5sH$0HL$H$HH$H5bkH$@H=^kH$xH sH$H$XH5sƄ$nDŽ$H$DŽ$Ƅ$sDŽ$DŽ$Ƅ$oƄ$`aH$H={H$HL$H$HL$ H$H H$H5NjH$HL$(H$H$H=,H$H$0H5H$PH y H$HD$0H$@HH$`H H$xDH$HƄ$zDŽ$DŽ$Ƅ$lDŽ$DŽ$Ƅ$8dDŽ$HDŽ$XƄ$tDŽ$DŽ$H$s&;|$Aąu$H$0SxHAąD$7<Hl$(HiDt$ E[HD$Hl$PHD$HHD$@H$D$X8@D$\D$0H|$@D$`D$D$dD$D$hD$ D$lD$D$pD$D$qAąH|$(tDHH,$EuH}H|$(Ht11AƅLcl$ LHDAąH= T$DL$1H5UDD$HL$H=nH=lAH -H=xH|$($H=x A{1H HZH=G A1H H)wH=ƥ"AUA6HATH5^fUSHFeH8dH%(H$(1H|$pLd$)D$)D$ LD$pHH$HL$HsH$H@HyH$HdH|$H$HL$H$H5~HD$pHH$HH$ HL$ H$0H5_H$H$HHH$XDD$xnDŽ$L$DŽ$Ƅ$sDŽ$DŽ$Ƅ$rƄ$PdDŽ$`H$hH H$HD$(H$xH )H$H DŽ$pH$Ƅ$tDŽ$DŽ$H$ dDl$HD$Eu(xLAąDl$HD$4xDÅ:LcL:IHH|$ Ht11ŅLLTAąHD$Ll$@HD$8HD$0HD$D$H8@D$LD$(H|$0D$XD$PD$\$\D$TD$D$`D$aAąH|$ tLHl$Eu~}D H$(dH+%(H8D[]A\A]ú2H t H=HAmxHl$EtuH}H}?HzfH=(j(L$HT$1H51H=_tH=\eH|$ A@H= A[1H HvH=c A}1H HEH=2 AT1H HbH=Af.fAWA$HAVDAUATUSHdH%(H$H$pL$pHD$81HHH|$0Ƅ$xnH$pH,H H$HD$8H$HH$HH$HD$Aąt/H$dH+%(>HĨD[]A\A]A^A_HD$0DExE1HT$@HHD$`H$HHD$@HD$HH\$PD$X@|$\HD$hHD$pfDL$xAą|$=|$<)HD$0L$8IH5Hl$zH1~H=HE1@PIHIH9u$$H511HE1PIHIH9u$$H51H$$$H5P1D$D$$$$H5 D$D$$1o_HAXE1fDP/IHIH9u$$H5E1)HE1P9IHIH9u$$H5E1HE1PCIHIH9u$$H5M1HE1PMIHIH9u$$H5U1iHE1PWIHIH9u$$H5U1)HE1PaIHIH9u$$H5U1HE1PkIHIH9u$$H5U1HE1PIHIH9u$$H5U1i$1$H5kD$D$4H$$$H5P1D$D$ YH^E1f.IHIH9u$$H51H$)$($.H5þP1D$4D$2dd$@D$<$:H5߾D$>$1'XE1ZHIHIH9u$?$>H51޿HE1IHIH9u$I$HH51薿E1IHIH9u$S$RH51VE1AIIIL9u$]$\H51Hl$0Et>uH}H}BHnD~ɉHl$0Eu‹}#ϐHD$0LHD$Mt LmIH|$LH5˜L5ԜH-J蘿sIk$I[LLHm$@LHHRH\$H1HL$zPHHHH9uHL$LH5 KHLH5L$ILLH۾$LHHHL$H1fDPHHHH9uHL$(rLH5yJH耾LH5OLnI$I9LLHK$HLL|$H+$D$D$IDL$$DD$ H5HLH|$$H5HLHͽ|$ LH5HH貽LL|$H5IL蛽LH5{L艽d$ITLLHf$9HLL|$HF!$D$D$IDL$$DD$ H5BLH|$$H59LH|$ LH57HͼLL|$H5HL趼LH5(L褼$IoLLH聼$TLHHfHL$(H1@P/HHHH9uHL$LH5!HH(LH5L$ILLH$LHHػHL$H1fDP9HHHH9uHL$LH5GH蘻LH5'L膻a$IQLLHc$6LHHHHL$H1fDPCHHHH9uHL$LH5GHLH5L$ILLHӺ$LHH踺HL$H1fDPMHHHH9uHL$jLH5qFHxLH5LfA$I1LLHC$LHH(HL$H1fDPWHHHH9uHL$LH5EHLH5Lֹ$ILLH賹$LHH蘹HL$H1fDPaHHHH9uHL$JLH5QEHXLH5LF!$ILLH#$LHHHL$H1fDPkHHHH9uHL$LH5DHȸLH5oL趸$ILLH蓸$fLHHxHL$H1fDPHHHH9uHL$(*LH51DH8LH5L&$ILLH$HLH$D$HD$DL$ H|$H5H请|$ H|$H5xH蒷HT$LH5tC~LH5\LlG$ I7LLHI$ HLL|$H)$D$D$IDL$$DD$ H5LH|$$H5LH˶|$ LH5H谶LL|$H5BL虶LH5ҔL臶b$IRLLHd$7LHHIHL$(H1HHHH9uHL$(LH5AHLH5XL$ I辿LLHе$!裿HLL|$H谵$"D$$D$&IDL$$DD$ _H5LHm|$$DH5ܓLHR|$ )LH5ȓH7LL|$H5AL LH5L$*IپLLHdHLL|$Hδ$,D$.D$0IDL$$DD$ }H5:LH苴|$$bH5)LHp|$ GLH5"HULL|$H57@L>LH5lL,$>ILLH $?ܽLHHHL$(H1@HHHH9uHL$蟽LH5?H譳LH5 L蛳v$HIfLLHx$IKLHH]HL$H1HHHH9uHL$LH5?HLH5̑L $RIּLLH$S軼LHHͲHL$1fDHHHH9uHL$LH5>H荲LH5L{V$\IFLLHX$]+LHH=HL$HD$1HHHH9uLH5=HLLH5H\$LH5HٱH߾\H5H1薰H>tfH$f;H5f HH9u>H= A1H Hn-ff.fAW1LAVAUATUHSHH(dH%(HD$HhealthyHT$D$H$uI{LsLkRLcVHH5HH谰L裯H5HH葰{ؼH5vHHv{轼H5eHH[{袼H5UHH@{臼H5CHH%LH5.HHH{JMH5HHLޮH5HH̯L迮H5HH譯H5HH萯ԻH55gHHr趻H5َHHT蘻H5ĎHH6zH5HH]H5HH @H5HHޮ#H5wHHH5eHH褮H5OHH胮@H53HH_@蜺H5HH:@wH5HHHD$dH+%(H([]A\A]A^A_fH-ƌ@H1H诬M1L=HL芬KH1HpKH1HVKH1Hp<KH1H_"MLHM1HKJ1H:H58MLH21ȫMLH1誫L%1LH臫1HJdH5fH1HIH1Hԋ,H1HH1H 1LHתL1H軪H1H蟪H1HhH1HP]H1H7:H1Hff.ft| L @Bv5fH*LFH ^Z \ L sv = L +INFGDAUH1E1ATH5_IUH-USHaq H8AD$(IcHRHihHH؀8HPtHtH1AAuA$u>A$vHH51蹨H []A\A]%DH H51聨ff.@AWAVAUATUSHH $HdH%(H$1IAmA](E}(A@IM@HGzGHHHH)HL$AEILiiaH)H)IH<$HL$HPIHHcLl$ AUHihHL=։Md4Ho HHD$0Hp HHD$8,@iI Hi¨aHD$H4$H4$kdH H9sHT$H5.11ۿl$,Lt$0Ll$8T<t|H5+11T$LD$T$LD$LL1蠦IM9tOAMFMt<t#<uHcA,fDHcA,fDHcA,fDl$,HD$ I PiH$i¨aHD$Ll$ HGzGIMHHH)HHHHr H$dH+%(HĘ1[]A\A]A^A_HD$ l$,HD$ w ADH51f ܵDGO1H`H5k-H-AM1H_H IM1L%sHVLIM L1H_ѤAM(1HXH5Y賤AM,H1HP虤AM0H1HHAE(HOl H5EH H&1PAMH1H'6AM1HH%A6IAmL|LhALD$PAUA( AE}( Df%f fALD$PAEfHDŽ$L)D$`LD$)D$p)D$PD|$pD$`8D$dƄ$AELD$H5£1LD$YLD$@L1HT$XHS㥛 HiL$P@BHHHHHL)IfDL$LH|$HH4ׂCLLD$HLH?HH)HT$H HL$PPL$oLLL$H)L$PoP)T$`oX )\$pH@0H$lLD$H5ZLLH1HHi@BH)HT$QH51-I1HփH5ۃ跡IAmzLD$PEH=葳D1H5ءkDf%f AfADH5̡18H$A}L¾HD$`HHD$pHHD$x1HD$PHD$XD$h@|$lHDŽ$f$賥LD$fL$E}(AEL)D$`HDŽ$ALD$)D$pD$`8D$dD|$pƄ$)D$P=LLD$HGzGHI)IIIA-DH51LD$ L1HIUSHHuHR(`u H[]H 0H=H+Et&uH};H}ұH芭멋}˵f= ATUSH=w H=ttdzIHkHcPwCCLHkFCsh@= 1[]A\fD= H=H*HDnf.fGDI$H{LHHSILHLHH) H)։H= vH=ҲIHtHrLCSLH财4H E H=v?DA$SATfTfDA$SATTff.AW#AVAUAATUSHdH%(H$1L$HL$0LH$`r j H%LHDHHHAąt0H$dH+%(HĘD[]A\A]A^A_@HpAD1莭AąK!LHLH1pADƄ$DŽ$PAą5H!HLH$@1H$PHDp(AHDŽ$0HDŽ$8HDŽ$HAąH$hHH1DŽ$t!HHH$x!HDp BHDŽ$`萬AąH= 1H^9@H=٠ 1H oH= 1HGH= 1HĮ:f.ATAHLM UH ݜDHdH%(HD$1HAątHD$dH+%(HD]A\H$x$Aąu=H,$Et"uH}DH}۬H蓨뢐}ذfDH ?t'H |=tH }w HHa# H H=v H|1賭q)fAU#ATUSH(dH%(H$1HHH|$wAąt(H$dH+%(u]H(D[]A\A]@IpA1LH$$EAątH= 1Hgkff.ATAHL_ UH |DHdH%(HD$1H&AątHD$dH+%(HD]A\H$xAąu@H,$Et%uH}oH}H辦@}fDH ?t'H %{=tH 1{w HH! H H= Hd{1۫nQATAHL^ UH {DHdH%(HD$1HAątHD$dH+%(HD]A\H$hAąH ҋ?t+H OzAtH YzAwIcH H H=Ĝ Hz1H,$Et&uH}H}蟩HWCf}蘭fD11_tH U %H=4OAUDATUH0dH%(H$(1H HH|$SH$γ 7Ip BL=AąufLp B1%Aąu&H$(dH+%(ucH0D]A\A]H=q 1Hy謩f.H=I 1H脩fAATAHL UH MDHdH%(HD$1HAątHD$dH+%(HD]A\H$xAąu=H,$Et"uH}H}蛧HS뢐}蘫fDH @?t'H w=tH ww HH! H H=6 Hx1sqfAT6H=uUH-wHH dH%(HD$1Ld$1LHH= t1HT$dH+%(u^H]A\DD$f.AH ]fAwHH H\HHDȿD1H5xH|$ DCMdHD$J ID$H;D$HD$XdH+%((HhH=߀[]A\A]A^A_0AH e\fAwHGH HL\HHDDH5S1wDsS1Dk H5]wAֿ1H5]w1AտH5]w Hs} AH [fAwHH H[HHDD1DH5*wEHt$ AH U[fAwHgH H<[HHDAH %[fAwHgH H [HHDpAH ZfAZHsH HZHHD<@AH ZfA"H[H HZHHD@AH ZfA wHgH HlZHHDDH5s1uAFf9fA fA bHs }VQAH ZfAwHH HYHHDDH5YZ1uSH YwHH HYHHDH52Z1@uSH YwH&H HkYHHDH5 Z1uSH FYwHH H,YHHD1H5YtIH5YLs1tEH-Ll AH1IytM9uH=yjxHH#KD$8Ho^M<+ HD$0HHHHHHHHiIHH)HHHHIHHֺ(HHHH)HH)1QH|$8H LXzZAYH XfAwHGH HWHHDDH5X1sHT$(1H5XgsH5XLs 1GsEH-Ll AH1IsM9uH=iH5{rPf.HD$XdH+%(Hh[]A\A]A^A_DSH5W1rDsS1Dk H5WrAֿ1H5WirAտ1H5WRrrDSH5W12rRSH5W1r7ff.fAUATUH L'dH%(HD$1HD$HD$MGL-jeHLLtsHHt$L0H HdPLeMLL'sHtHt$L0HN HH}Ht$Aąxx|$Ht2H@Ht)HE1HD$dH+%(H D]A\A]H )v E1H=T fDHɍ .@H5IW1H5V1ݾAqH5V1A蹾SH5V1A蛾5H5VAH5yAc}fAW1AHAVDAUL- ATUH-VSHXdH%(H$H1H|$ fL$$Lt$ MLt$HHH|$D$(SHD$ HH yHD$0HD$HD$@H>yHD$PHZyH$HyD$8D$HLl$hD$paH$Ƅ$nH$Aąt-H$HdH+%(HXD[]A\A]A^A_ÐL|$ M|LDI~HIHHL?ÅuA~8trLd$Mu#M|$HIHMHLuAT$8H|$/AąL|$ fH\$LfDH{HHHHH5~u߀{8Lt$fDM~HIHMHL\~uAV8t$H|$>/AHl$Et<uH}>uH}H{kfD}踃H5x1蓻뙺zBzfAWAVAUATUSHH $HH $H(HQfdH%(H$$1HAHH$1H$H$HHYH$H~H$HL$H$Hd H$H$H$H|$XH$HVL$H$H9Ld$`H$H#wH$0H5H$H$ H$XD$HD$pHD$PHDŽ$DŽ$Ƅ$nDŽ$L$DŽ$Ƅ$sDŽ$DŽ$Ƅ$dDŽ$(DŽ$8H$@)D$`Ƅ$`SH$hH$H$xHQH$HH$HH$HMH$HH$H$H$HQH$HQH$0H$H$PHuH$`H H$xH$H$H uH$H_QDŽ$pDŽ$Ƅ$oDŽ$DŽ$Ƅ$vƄ$8eƄ$pH$Åt]hjD8Ht$`Ht|$hH|$pt7wH$$dH+%( H($D[]A\A]A^A_fDoǐH$Ht$LADž$tL$LHl$XD$EEu0H}LLd$`lADž<D$Hl$X$E~}UH$Ld$`HDŽ$H$H$DŽ$0$HDŽ$DŽ$D$DŽ$Ƅ$iADžHD$X$08@$H$HH$H$Ld$`HDŽ$DŽ$0H$DŽ$$DŽ$Ƅ$iADž$*@Ѓ0 HHHHD$oHl$XHD$(HMD$D$EHT$($\H$@H@DŽ$X8Ld$`HDŽ$@HDŽ$HH$PDŽ$`D$dH$hfD$pƄ$r}ADžHD$(D$L(Au D$EAC@AFD$4Ld$`Lōx@|$00H$HH$|$LMcLl$8HD$՘HtHHt Ht$PLEH$E1HD$ -H $EHT$AHHTPHT$E9AD-D9vD$4DD)Ń@D$0$D$D$$D$$D$HD$X@HL$H$$D$H|$ HDŽ$H$$(D$0H$$,D$DŽ$8f$0D$DŽ$ D$$$2C{ADžLD$P|$LLD$oHHHLD$L$0ӉH<$DLd$`DHl$XEt_uH}Ld$`|lH}wHrfD}DLd$`訐ÅxjD$Hl$XR}Ld$`z뮐i|$LHl$P蛖HtHHt H|$8HH|$(FrHl$XF@A5H=wLd$`mf.H=JLd$`mDH=FmHl$XAH=h A1H ΏHם%wH=h A1H HLd$`v5H=h A1H gHpLd$`v{H=;Ld$` H=Ld$`@H=Ld$`ϔ+oH钐fAWAVAUATUSHH $HhH5fHxdH%(H$X1AH$IH$H$)$)$L$)$)$HH$@H/IH$H$XHH/OH$HyH=!yH$xH$H$HxH$HH$H$H$HxH$ H$hH$H$HiH$Ƅ$nDŽ$(H$0DŽ$8Ƅ$`sDŽ$pDŽ$Ƅ$zDŽ$DŽ$Ƅ$yDŽ$H$H fH$PH5GH$`H5PHH$xH5DlH$@H$H$H$H5nH$H=nH$H$H$H5nH$`H$H$0HnH$H$H$H5zH$H=nH$pHCH$(H tlH$8H5kH$PHfnH$H$H$H=nDŽ$Ƅ$8dDŽ$HDŽ$XƄ$MDŽ$DŽ$Ƅ$lƄ$fƄ$XrDŽ$hDŽ$xƄ$mH$H$H$8H$H$HH+kH$XH:FH$pH$H$H-kH$H$H$HH$HjH$H$H$DH$LH$(H|$(H$H vDŽ$DŽ$H$Ƅ$aDŽ$DŽ$Ƅ$0pDŽ$@DŽ$PƄ$xPƄ$tH$讴H$HD$($XPHl$PH$PHD$PHHD$XD$`0T$dHD$hD$p\$tD$xD$|S^AƅP$jL$Ѓ0 HHP CL!DPfDd$Et1A+H$Ht$H1HHl$<,H$H11qD$L$qH|$0LHHHD$aD$~H=a L1HDoH$t|$rDHl$(EuH}cH}anHj?xH]_Aƅb$HD$(+\D0H$XdH+%(HhD[]A\A]A^A_@H=` Ⱦ1HB o[3EHhH=` 1n[Hl$(E}qH Y` AH=SBPq[[L|$0L1L`|$LLkAƅTH$Ht11oD$L$E1M&H$1HH$ $D`tf$t@$H$fL$)$H$HD$ H$HD$(L$)$DŽ$P)$@$$1H$$H$fD$$$f$$H$H$lH$Lo1H|$@Al$OE&D8L@gH$t |$|oL$g@ALH ffDD$=$mH=G@bgH$AlbkH=Tb7T$Ht$H|$8]D1AH=u] Hek@HT$ H5e1XHT$@H+T$PH5we1Hi@BHT$HH+T$XW~DH$a~fDLl$8L1L]|$LLhAƅH= ?Xa;H=>DaCH=\ H1A=H ZjzH=g\ A61H 0HIjH= H$cf.ATUSHH $H$HVdH%(H$1HRAHHD$H|$`1DHHCH$H܂HD$`Hl$H|$HMH$LD$`HD$pHD$HH$HfH dH$HH$HD$H$H=HD$D$hnD$xH$DŽ$Ƅ$oH$DŽ$DŽ$Ƅ$rH$ Ht4UD H$dH+%(HĐD[]A\fDH|$Ht$豬AąHD$Dd$Eu(gxHXAąDd$HD$\$xHT$ HDd$LH$D$8@HD$ HD$(Hl$0|$fHWH3@t"@ HgvH/HD@HjOHcQHDQH%QH3H3HuHuHxuHQuHOHOH uHE}H2HNHXHXH2Hu2HKtHANHtHtHsHMAWAVAAUAATUSHH8DD$ dH%(HD$(11HD$fD$&HcDd$Gt/HD$(dH+%(ZH8[]A\A]A^A_L|$ H51CIDL3L 1L <*LIT$ DLL 1L *LHD 1H5z1HC:^H0HIYHl$SLH5HIDH{HCWLH51HIT$ DHQHWH5ELHWID/SH5aLH=I#UUSHHG H_O H5HDH5?V1GS1H5i0GK"S 1H5KVG=upH-HYL 1LdxH aHZxH5UxRGHZYCt H[]TH0H[]DH(H5/1GqSIHzHHH)HPdH%(HD$H1HHǂHH$HD$AHT$D$@u]A@D$1HHHD$(1fT$8HD$ D$0fD$4D$6\$7YHT$HdH+%(u5HP[H=mK A3H qHQYxSLc HLI @H HPH9uHTH5.Hj HTHVc Hj HTH j He.Hj Hk.Hj Hz.Hi Hj HTHj HTHSk Hq.H`k H|.H5i H5pTHhk Hv.Huk HTH5i Hk Hq.Hk  t =~HH H=uLAUATIH5}USHHQHtmHź1HYQHD11HIBQLzTI$HHt(HLVHHCP1H[]A\A]H.PDDAWAAVEAUAATAUHSH D]4A)txHDA9AFED1҉E(E$GQu,E~U$HuDGyH=tD$ kMD$ H[]A\A]A^A_H1[]A\A]A^A_1ff.SHGHA1HHxHHǀHH)1HDHHC$PuC4[ff.AWAVAUATUSHH $HH $HfH|$IϹIH$ILLL$IL,dH%(H$ 1)$)$HH$HHRL:IHt$ L}VY^uD$(%=@t LjFM1L$AWL`+ATLHXAZLﺤ1VAąHu cHH)tXHHDEHyAD(AA~DWH$ dH+%(u^Hĸ D[]A\A]A^A_@HD$LH5*HP1AE1@kAD(ALJMHnfAVAUATUSHH $HĀfH^D6dH%(H$x1HD$pHD$nHDH1HHD$`IAD$hfL$l)D$0)D$@)D$P0@HH$H\$D$0D$D$Dt$D$ Dl$$D$(D$,@uSLt$0HDMLOAU?L>FXID$IZALHH0HH$xdH+%(uAHĀ[]A\A]A^H=D A1H kHyR lLff.SH0dH%(HD$(1H(=q $HD$HGHD$\ HD$uHT$(dH+%(uOH0[H1, Hf\ uCt ǃ@tǃKfAW@fAVAUATUSHHXdH%(H$H1H|$@)D$ H<$)D$0HHA…DDcaD$AHH NHL$(TDpDALd$0AHl$8McATM1UEDCY^ALIAuH=wL%M|$t%HxH$1DT$FDT$Eu(HCLL$0H|$ LLD$8HH0mAH$HdH+%(HXD[]A\A]A^A_fDHDExL4$HL$1LLD$|$AHH$@@LHDHƄ$AEpx1ED$tf.H U&HL$(DpDAALd$0Hl$8Mcf.ATMDEU11;B_1AXALIAuH=wL%8LpH=LA A"1H }gH.v|OH=A A11H LgHuAEO8H=@ A81H gHuAO~H=@ AA1H fHuDT$NDT$NHH=f(HT$(mHT$qff.ATUHHX?dH%(HD$H1HEHH$HD$HHD$ HHD$(1HD$D$@|$HD$0fD$8?Aą(u-HD$HdH+%(u8HXH]A\YpHD$HdH+%(u HXD]A\IGfSH1H dH%(HD$1H*EHT$HS㥛 Hi $@BHHH拃HHH+H uHD$dH+%(u2H [@HD$dH+%(uH H5z#1[9FAUIATIUSH"f.:H9u(IIAmA$uH1[]A\A]H[]A\A]ATULSHdH%(H$1DBHOADAAIDI)L9A2@HH<HA?wHDHHH!DŽHDHHul>HEH$dH+%(H[]A\fDfopdD$ ted.HD$$)$fodd)D$FHE1fHDHH SEHEtDIHLRH1QL>LLmFHE11fIHEѹVLAHL1u>LL*FHE1ZDf.AWDVAVA)AUATUSHhHL$NLD$ LL$(dH%(HT$X1҉L$$A9!HAEE1D$8Lt$M}fD L1L  DL$=H|$HT$@L?DL$tLDȃH|$ D$AD$D$Dd$AD+d$AD;$$|YD1AD EtEt܋D$Dd$D9tHL$(Ht D$8 wD Dd$AD$8D;$$}HD$XdH+%()D$8Hh[]A\A]A^A_fDL$H 2 H=%tCHE_PR1E1AH5>1zXZEt-H '"HCHQ7H<PH&PH=s1 A1H WHUf?H=B1 A1H VH$fr?8AVAHAUDATUH-NSHdH%(H$1H|$XH\$PD$IHl$PHHv^H|$D$XtHD$`HD$H =HD$pH=D$hD$xH$Aąt1H$dH+%(HD[]A\A]A^H|$PHu fH{HHHHHW;u{8H\$Ht$D$Dt$HAąDl$EHD$fHD$D$D$(D$ 8D$8CH|$D$$D$,Dt$0D$DDl$ED$F>AąH=9H =/ H=Yq<@f.H5 =1xHl$EtHuH}c1H};H7tD1H5G;wHl$Eu}?a_H= <c;D1H5R<=)k}H=,S'[-6ff.fAW1AHAVL=DAUATL%USHdH%(H$x1H|$PfL$$Hl$PIHH[H|$Ld$PHD$`HD$H <HD$pH;H$HH$HD$H$H9H$H2D$XpD$hD$xƄ$sL$Ƅ$nH$~AŅt,H$xdH+%(;HĈD[]A\A]A^A_Lt$PM"LHf.H{HHHHL78u{8uLuHHHMLL8uD|$}8D$Dt$H\$E1HD$fHD$D$D$(D$ 8D$8LCH|$D$$D$,Dt$0Dd$D@l$ED$F:AŅxH= H , H=&n =fHl$Et$uH}F.H}8H4t} HPHEHHhHPXHl lHhxHH-> Hk)H> IH+ {1ҾHH$fT$8LHD$Lt$D$@|$HD$ l$(D$,HD$0&EH$HdH+%(HXD[]A\A]A^A_@H551 H= H55HPX1 H= H55HPh1 H= H5 HPx1{ H= HphHHHHHXHhpHL1lHHxHP@H5 LxPLp`HHHHI= 1* JH5 1 JH5x51HH5j 1H< H5h 1H-< H $ &H=055ErLd$@AHstring.bHD$@inLfD$H1D$J3Ņx]H^< H5O< "HH;G< uE1 z5DH I$ "H=PmC5ĐK8D"H=$ LHTI1AQ2H=# A1H YIHX(2GH=# A1H (IHX1A8!H=# H:H116+ILf.AWAVAUATUSHH $HH $HH $H?H3fdH%(H$31AH$HHl$`)$H5LD$TL$DŽ$Ƅ$HHL$hH|$XH$H$H  HaH$H IHVH$HbLH$ HL$pH$H2H$0H oIH$HRH$@H_IH$XHL$xH$H$H$hHOƄ$lDŽ$H$DŽ$Ƅ$sDŽ$DŽ$Ƅ$oDŽ$(DŽ$8Ƅ$`fDŽ$pH$xH mH$H$H$H5H$H 2H$H$H$H 2H$DH$H2DŽ$Ƅ$aH$DŽ$DŽ$Ƅ$tDŽ$DŽ$H$#rADžpH$HD$XxH$0ADž7$HD$X` @$HH$H$H$HHD$HDŽ$H$DŽ$0HDŽ$DŽ$Ƅ$nADž1H$HHt  u$D$$$$ L$M. H5L*H5Lr* H5L[* H5S7LD*jH|$`lH5:11gD$(Ld$X?!HD$Im)IMHHtelemetrADŽ$!y.biH$!H$!nf$!H1HL$ m-HL$ A8DŽ$@HD$HDŽ$H$A$HDŽ$RAD$$D$(ADŽ$H|$$HH$HH$fD$+Ht$D=QHD$@ HHH H:\$ AH\$D|$(I1WLDZ=IM9HL$L$Ƅ$?+y$H5/1e$D$-H|$}%Lu%D<$H5/1e5$H5 116H.ADž H=d7')Hl$XE7uH}H}@)H$H$3dH+%(HĘ3D[]A\A]A^A_@HtH$[@H5-11d$DŽ$`fxHt$TADžhHD$XGfD H|$` H|$hH|$xEE1 $AH5$01DDt$HD$pfH$1>L\$XHq)$1HD$(1 EHH$L\$HH$ )$HH-L߾HDE1)$ H$1HHD$8jA[[$¿1H5/D$ED1D$M%D$H=- HH1l(D<$}(+$1H5.D$|dH=+/H-&$1H5@/1$2d$11D$1$1H5-/8$1H5I/1$1H5V/1$1H5c/1$2H5p/1ӿ1H5{/oH=%DDc@DHA31zD9uݿ #uH= g%H$HE1HD$(HhDD$(H|$ AYAZH=//L$%H5)1$H$HTf$H51H$H51H51A$H޿1IpL9u L$"$H5.1>$H5.1#H$H5.1H5.1HD$ Hh@@A<$IZ"I9u L$ E1@"H$H5.1L5{/H$H5.1H$H5.1hH$H5/1MH$0Ll$8HD$HHD|$DCL%DL1HHMD1H5 /HMD1H5"/IIuH=7/L%VLD|$D"L1HD$ L$HAUH޿1II9u H=.u"L1VHl$ L$HfA$H޿1I(L9u H="H$HH$HH,HHHptHHArHE1DSDD$(HH|$ I ^_$H)ݹI<,諔D|$DH$8L|$81DHHH;A<uLeMtHEILAMֿIIvAbLH%HLT$ }LH5-HI1HEE1AVDD$(LH|$ ZYLT$  M)A AغK|LKH5%11v\ H511U\$H5)1 D$HxH5%1H$1 \H|$`{H5.11[D$(Ld$XH5|&11[H|$X1Aą$1H5&1[H=HD$h1H5&1v[HHD$xIALMH%H'H$D|$DHH$H<H$1 HcHHstH 6HH HA2HDE1SDD$(HH|$ IA[A]$H)ݹI<,iD|$DHl$H1L|$8fDHHH A<uHUHtHEL4L$AMIIvAsLH%HHT$ 9HT$ HE1AUDD$(HH|$ HD$0AYAZHL$ E M)AغJH=p.5jDA!H|$LIA8H= IH81H|$|LtH= A1H -Hz=A w+HtG w;HqHcH>HH/HCÐH)/H/H#/H"/H!/H/H#/H&/H%/H*/HFAWE1AVL50AUL-<0ATIH=#/UH-/SI\$&HA $1H/H5/AL$1H /H5.H=/AD$CDH5%/1rKH1H/ATKH1H/:KH1H/ L1H/HH#KHKL1H.IعLH.1LC1H.LH@KH1H.KH1H.mKH1H.SE9|$A$H-H5-1%I$1M$H-H5-H []A\A]A^A_cAUH=[DATUHSHU1H5Of}t8Le1L-OLL1IuE9H5փ1HL%RH>H5e1+L1HH9uH []A\A]yfAVL59AUL-o-ATL%|-UHH=~CSU1H5GU1H5GU1H53GvU1H5EC`U 1H5gGJU1H5G3U1H5GU1H5GU1H5GU1H5GU1H5GU1H5HH5#,1LDHt)1LLyHt3HLDHu׹LL1KfH5G1HL%PHH5B1fDL1HH9u[ ]A\A]A^K ff.AUIH=AATMUH- SI]HAUH5A1yAUH5A1aAUH5 B1IAUH5%B11AUH55B1AU H5MB1AU H5eB1AUH5uB1H5B1fDH1HL9u IL%OI AUH5bB1fH5$*1SL1H:I9uH []A\A] AUH=#BIATMeUH-SSI]H AUH5 B1H5UB1H1HL9u I]$M AUH5MB1AUH5}B1iAUH5B1QAUH5B19AUH5 C1!AU H5=C1 AU H5mC1AU H5C1AU H5C1AU H5C1AUH5-D1AUH5]D1yAU1H5DbAU1H5DKAU1H5D4AU1H5EAU 1H5KEH5E1H1HL9u IH-9LI6 AUH5rE1H5E1H1HrI9uH []A\A]fSHH516S1H5$S1H5&S1H5&S1H5&S 1H5&S$1H5&S 1H5&HS1H5HS1H5lS(1H5&VS,1H5&@S01H5&*S41H5&S81H5&S<1H5&S@H5&[1ATAH1H0dH%(H$(1H|$Xft$DLD$PD$HHs&H|$D$XeHD$PHD$H CHD$pHa&H$HlH$HD$H$H`Ƅ$sH$LAąt$H$(dH+%(lH0DA\H|$Ht$1AąD$HT$fHT$HT$D$ D$ 8D$(D$8RT$$T$H|$D$ET$0T$D$FɈT$DI AąJtXH=BH H=< fH=4 +@H=B T$H5B1T$H51H=H.1A> H Je0D$ff.ATAHDHdH%(H$1H|$HLD$@D$HH9dH|$D$HSHD$@H%'H DBHD$PHD$HD$`HxD$XD$hHD$pJAąHD$D$ 0HD$HD$HD$@D$$D$H|$HD$(D$0HD$4fD$H= Az 1H :cH,9f.;ATAHUDH-SH dH%(H$1H|$HH\$@D$HD$IHHbH|$D$HsHD$@H%H @HD$PHD$HD$`HqvHD$pHD$XD$hH$Ƅ$nH$hHAątQHl$HtEHH$dH+%(KH D[]A\DH|$@HuqH{HHHH_HuDc8H\$HD$fHD$8HD$l$D$D$(D$ 0CD$$@ʼnD$0D$1^>hfH}H}>ff}8PE1AfH5>1=CH|$D$$f.H511=HD$0:H=A 1H 4_He);$HWAWAVAUATIUSH(^H|$H Ht$CxHL$,CpQ HHH|$(IDžHD$E1fDLLL,LAEEtD9w܀|$t'HD$H5uH|$L8HzHE>1H([]A\A]A^A_DD$E1uf.Ch,C`H?Hu1H52<AWAVAUATAUHSHXHO(H_@T$/HH dH%(HD$H1HG L$4HHD$b&,$ $H$1<$AH5;Hu0H=FaH=E,$DEAJMoL{,E1ҋ{Et]D9tXJD-,H$,$HHyIH+HCHL,tLS,1M{M<*LDEuAD$|$H5LT$ $DH1|$/D$$l$fHH51<$L1H5:rS1H5q\HS1H5rEHS1H5v.HS$1H5|:Ht$ H=dt`DLH=db`,$f.E1E1D@HD$HdH+%(u+HX[]A\A]A^A_ $H$H?fDAWAVAUATUHH=9SHHdH%(H$1VHH51,1H59CH591CH591CH5 :T1CH5:T1CH54:T1C H5I:T1vS 1H5\:_S 1H5u:kdEH5:1+H5:1H5:11H5:HH|Ld$0LOL1H5:H5;1IHL~1MH5;L-&ZH5$;1@H5:;1&fDDELLH1HIL9uLH5#;1E1Hk$L->; GL^1H H"*H5WMDMDLDE1AHzAuHkHE1Lt$0ID1AH5:IK|hHLL1H5IIuɿ AIAuLE1L5:AL$E $D1LAIED$AuϿ LE1$L5:AL$E $DLED$1AIuAuE1Ll$0L5D1AH5:DJ8HLLL1IIuʿ AH|AuHâ1L%:KD LDC1HuH$dH+%(ujH[]A\A]A^A_H5a91}`H5A91]<H=a7TJf.UHAWAVAUATSHHxHuHwXHHdH%(HEHGHHuHwhHHuHwxHuHw@HHuHwPHEHuHw`HuHwpHxHHHH)H9tHH$H9u%H)H'HEHpHH%HHHH)H9tHH$H9uH)HHuHHhHHH)HH9tHH$H9u%H)HtHLH581LsH`LcL- H581AL1IM9u L{LsH581_L%6AL1I9M9u Ls(Lc@HS 1H58 H5D81AL1IM9u L5:E1@HS@1H58L%HSH1H58HSP1H58tHSX1H59]HS`1H5;9FHSh1H5d9/HSp1H59HSx1H59H=LDDL1B;IAIuH=E1LfDL1B;IA~IuH={E1yLqDL1B;IA>IuH=QE19L1DL1B;IAIuH='E1LDL1B;IAIuH=E1LDL1B;IA~IuH=E1yLqDL1B;IA>IuH=E19L1DL1B;IAIuH=E1LDL1B;IAIuH=UE1LDL1B;IA~IuH=,E1yLqDL1B; IA>IuH=E19L1DL1B;0IAIuH=E1LDL1B;@IAIuH=E1LDL1B;PIA~IuH=E1yLqDL1B;`F;pI8IuH=Y6LE1+DL1B3pIAIuH5)31LLAL1IM9u "HCHHu]HCXH@HChH,H{xHEdH+%(rHe[A\A]A^A_]HLHL HuHLpHELmLH4IH=5McIH]L=%5L5~5K,L-C5HA$L1IAT$L1AT$L1IT$H5J51vAT$L1bI9uH]HCXHHuHLhHELmLH4IH=5%MIH]L55L=5K,L-5HEHX5HDA$L1IAT$H551AT$H1IT$L1~AT$L1jL;euH]HChHHuHL`HELuLH4IH=5,MIH]L-,4L=4K4L54HEH_4H@A$L1IAT$H541AT$H1IT$L1AT$L1rL9euH]H{xLeH= ]H=4IMMHxLuL-4HIA HL1HDI9u{f.USHH8HO(dH%(HD$(HG HΉL$H HHD$HD$H L$HL$ HJHHT$l$H9t@ *J(JL$HD$t'Hl;H5>HeH9uHD$(dH+%(uH8[]$@UHSHH@;H5HH9uH[]fUHSHH@;H5HH9uH[]fUHSHH@;H5nHH9uH[]ft8UBSHlHH;H5&HMH9uH[]Ðff.@UHSHH@;H5HH9uH[]fAWAVAUATUSHHt$,T$OdH%(H$1HK(HD$8HC HΉ$H$H H$HD$0H H$H$ GHH$,$H9t GLt$01AAdH ߷L<$LL|$8H5* HLDd1H %JL}LuH5LLHHSLH56kHSLH5ZSY,$bL$LD$L|$0H -d1LLL|$8H5u HL(HS0LH5HHH5LIHD$@LHH[@,$wfUDMHD$HC,HD$ D$,tq;CtlJD%,HD$l$HHy,$<$H+HCHL$tHC,H(HD$1MHEHD$ D$,uAH|$XHD$XD$HHi1d#|$OL|$XLgIH|$@LLILL{yHHt HYHH5<LLt$`Id1LH P$LHH5LZMd1L$H LLHH5LDKd1L$@AH LLHH5LLKd1L$L5IALLSLKHH5.LLKAL1L$ dLLHH5SLFL|$0LK$L1AdLLHH5LHT$H57LHT$ DH52L詗H|$XL$H.fDHD$HD$ f{XHHt H8HH|$@LxfDH|$8H58 H1+ H$dH+%(u8H|$8H[]A\A]A^A_,$L$LD$I?HDAWAVE1AUIATUSHHt$ L$H\$@dH%(H$H8HD$@HIHD$HHHD$PYA}HH5VHHZAETHHZHl$0ELIH +)1AmH4LHHsH|$LLAIAuHl$L|$E1H\$8H\$0Hl$H|$E1IH (1TH+@HL$LHD$LL4(!LHLcHHuHt$LAHH|$?AgHl$L|$E1H\$8Lt$(Hl$E躀LIH ?(1An0H4LHHsH|$LLAIAuH\$ Hl$H5RHHH5RHHgHH5IHIHHL$L蘴LHH5)L|$`HML5 H\$ >H5HH H5 HHH5 HHH5@HHHHLDLLH1HII9uLH5@HH,HH5H1 _HH$dH+%(|HĨ[]A\A]A^A_fDHD$H=L<(cLHL=HD$H=L<(;LHL}2H=^?Off.@AWL=AVE1AUATIUSHHdH%(HD$81A<$HHD$ZH5xHHA|$>HH5hI\$&HRAT$IŅEf{AHLHH{H5<HH{H5.HHgHH#{H5yHHBH{H5HH'H߾H5HHH{H@H5iHH{+H5HH{H5HH{H5 HHHLE9t$H\$LHl$H5HaA$H5dHHA1f#M$M$H IfD$0H1)D$)D$ D$2HH5HHHeH5H1HG HD$8dH+%(uHH[]A\A]A^A_yfAWAVAUATUHSHHdH%(HD$816}I*H5^LLH8ff}HD$0)D$)D$ tYLe1Lt$L=AL(L1LILLHE9IHLL=LzH5;LHf)$DHLH1HH I9uLH5rJLH<LH5 H1 oLHD$8dH+%(uHH[]A\A]A^A_ATUSHHPdH%(HD$H1I;HH5IHH{sH5 IHH{XH5IHHf{>H5IHHL{ $H5 zHH2{ H5*HH{H5HHH{H5HHH{H5HH{H5HHH{H5HHfH59HHtf@1LLLH F)$)D$)D$ )D$0LH5PHHHHH5H1 MHuHD$HdH+%(u HP[]A\AVIAUMATL%USI^HPdH%(HD$H1fA>HZH5HHhA~>H5yHHLA~"H5tHH0A~H5GHHA~H5kHHA~ H5wHHA~ H5!HHA~H5gHH@;HtLHHL9uAIQH57HH_f@1MMLH C)$)D$)D$ )D$0LH5;FHHHH5H1 8H`HD$HdH+%(u HP[]A\A]A^ff.UHAWAVAUATSHHHHdH%(HE1CHKHHHHHHHXHHHHHhHHHHxHHHHH@HHHPHHH`H@pHHxHHH)HH9tHH$H9u%H)H HHhHH%HHHH)H9tHH$H9uH)H HHH`HHH)HH9tHH$H9u%H)HtHLHHHXHHHHHH)H9tHH$H9uH)HtHLHHH%HPH)HH9tHH$H9uH%H)HtHLHHpLL5|;LcHHH54H%1LHDžDžfƅfE$LLH1I~HIL9uHH aHH5$H蛿HfHHLaHLI)IfDE$LHپH1IIM9uHLLH5?BHL H{ Lc(H@H5vLHIEfAEE$LLH1IVHII9uH@LH5HLwH{@LAH52LHO{P'H5LH5{X H5LH{`H5LH{hH5LH{pH5LHͽ{xLH5LH謽HfLHHLI)E$LHپH1IIM9uHLHH5H$HfLAHLIfDE$LHپH1IIM9uHLjHH5H褼HfLAHHIfDE$LHپH1IIM9uHLHH5H$HfLAHLIfDE$LHپH1IIM9uHLjHH5H褻HfLAHIDE$LHپH1II M9uHLHH5LH,HfLAHIDE$LHپH1IIM9uHLzHH5H贺HfLAHIDE$LHپH1IIM9uHLHH5HA}H5LH"A}H5LHA}޶H5LHA}öH5LHѬA}訶H5LH趬A} 荶LH5H蛬IL1HIILJH)HDDLHH1HHIL9uH|$Ld$IILL=rƹH5+LHA}ڵH5L LHf)D$DHLH1HHcI9uLVH5.LH蔫LH5cH1Q ǺLH$dH+%(uH[]A\A]A^A_%DAUAIATS˹HdH%(H$1H|$XLD$PD$D$HHHkHHD$PH|$DHD$XnH$SAą$H|$HD$D$ 8HD$HD$^GD$$H|$HD$0D$HD$(HD$8D$@D$DD$E\$FAąHD$xDLl$AEuI}uI} LĶH$dH+%(HD[A\A]DHt$sAąu|$H|$H H=蚾TDLH5|1*4DLH5j1 DA}W6H=+A31H H [t̴ff.HPff.HXkff.AT1AUHSH5L1H59Av6AD$H]LdH-fDH1HL9u[H=]A\ff.fAWAVAUATUHSHDgDAEfH+L5LDH4$LLцD$uD$,|$,MLNH=xsC\$(DD$(HcH9\$0|$u H|$`SD$uD$,Cf)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$)$g E1D$HD$pHD$xfDD$vfH|$Ƅ$f$AL$)$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`DG4L1H ILHIuHH<$H5bH;|$HL t1fHDD$vLɺFf$1)$p)$)$)$DŽ$胡H{L4$H5HL赛H$ XH5LH薛L$pHT$xLH5|$,H4$H|$PrDD$uD$,Cf)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$)$g1D$HMt$ D$pHD$xfL$vfH|$Ƅ$f$L$)$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`E$L1H IlLHlM9uLfD$uD$,sLD$MLH$DD$uD$,sLD$MLH$ʉDDMH-AH L1H胫EHH 5L1gMLH H"E1GDCHLH 1)< AHkHcH>DM"fE4$Ml$D$,)$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`C3D$HH$H0H$H$pHDVH|$BL 1fELH$ f$dF1)$ )$0)$@)$PH|$HDŽ$`H|$HL4$H5bHL&HΤLH5GH DLLH5 fD$,H$GfDD$,H$pH$fDD$,H$?fD1LL~M.f.H= d,D$,H$pH$fDH-VD1HHDHHJ1L1H4H5;BҔKH1H踔HcT$,LLH=fDL$,H<$LH51LL$H@MG4L1H aILHIuL%sA1ILH ?L胧|$HDD$vL1H "HULLL$ H 14T$pLHt$xH=7G4L1H I,LH,IuHH-@1HmH&|$HL$vH`H5=1H1H$ H6ޒT$pHt$x1H=rfMtKE$L1H IdLHdM9udf.E$L1H ILHM9ufBA|$ Mt$ H=D$pID$f|$vHD$xH$  诂D$HpDBA|$H=ϮD$pID$f|$vHD$xLH$ dD$Hrf.H$L%HL$8gH|$PqHT$PHt$hH|$tUMELH 1H^诤LIH `Hj>1菤LLLH=DHD$H$~)$pH$pL'HHAPLL$xH H1^[A\MLH距H|$0D$uHD$P7^HT$Ht^H$HtQHD$XH58HHE:1H$xdH+%(HĈ[]A\A]A^A_1@HD$ HAoHD$`) $HH51規*DHH51脏H1HH5<g1LLH=c1H5M1f<E4$H$)$pMl$H=C3D$D$uD$,:SfDH5 11H5e~H5^1H$pD$HD$H8kD$uD$,ff.fSHdH%(HD$1uH=I'Ht$u+|$u$kHjHT$dH+%(u.H[ÐtkHNk@2kHjĚ@AVAHAUDATUHdH%(H$H;H|$(LD$ HD$1HHعH|$D$(oHD$ HйH (HD$0HD$HD$@HqD$8D$HHD$PAąt)H$dH+%(iHD]A\A]A^H|$Ht$ Hl$fDIFI@AFA @AVAAFAAFAAFfAf?@ǃh@2\$Ld$E1I<$Ht/HDH耏u AD$t!I|$HIHHuH5褉A|$8tH|$H|$趌HD$hdH+%(<HxD[]A\A]A^A_DkH=Ht$`1蕁H\$@;LL$`L9 jLd$MEH 1AAH/IH= Ht$`1褎AHD$@DE4LL$`L9 Ld$MEH fH=ɂHt$`1̀IHD$@0LL$`L9 ALd$MEH )=@L5yHt$`1LjHl$`HI9HDuEt}~IֹPH=L1E HHHzHE9 u߄tHMtҀ}uHwA|AQEx HtHCHHEHD$(dH+%(H8D[]A\A]DH|$1蜉f.1H膉H}HSH1H5u7vD1H55!vH$H+T$1Hi@BHT$H+T$H5u>f.ATLIHdH%(HD$1HLHczE1uL$L1L{IHD$dH+%(u HLA\{ff.UAHDHAWAVHAUATSHIH8dH%(HE1ƅHDžHHHƅsHHH HHHHOH H`[H8H~DžDžƅ@nHhAąUHHmH{HvAą_HAAAtEHH HEAQPH511DB XZA1L5L-L=DHPpf IcDL>@H{yH{v{xHjfHH=L L= LDH=eLDHVLP1RqH 9;Hf.LxHad@H3T@HD@H4@HԪ$@H@H@Ho@HT@fDE1AHH OkHEAH5[1˾fDH5!1譾HDžHACH[w$fD{p8HqsH5 H1KD#AUH0-OH=uAl 1H HA|HHH֝HHfDUAQHH5fHAVAUHPATSHHdH%(HE1)HDžƅHH }HpH5 HH )HHH5HHHHHHPHHH5HHHH &H`HH5HHTƅXvDžh ƅoDžDžƅdDžDžH(HHHH "xHpHHH HXH5fHH HHܛH8HH57HHH HHHHPHXHIH H H0DHhHƅ0nDž@DžPƅxNƅtDžDžƅrDžDž(ƅPtDž`DžpHxgAątPHHHtHzHEdH+%(RHeD[A\A]A^]HPHuH{HHHHH5R|u[8HfH HIDž 8(8B$ƅF0(@u-HEL6AąE@IHHHt ?m AAfAF fAFHL~AąLyAFD>9fH{wrH{};f{%1fH5A|1͸ HH5/D DEPH13jHXZH)@6kj8XmHH5]12D11?~AŅ@Lzj8HlH5H1׷D#Ai8HlH5hH1觷D#AwuJH={nA 1H LH]|Fvgi8`lHH5H13AHrH镗陗H钗H鏗H5ATfUHSHHHFHwHwHEHtEH][]A\ÐE1A"1HsHEHt H][]A\LH} IL!mu]EH}1LLemH}HuUvx HErHuHt}H}tuHEHE1CmfH7Ht4SHH{umHHC[[ufff.@AWAVAUATIUI SHH Hy1E1E1A;ǍIHH$AEHHD$IcIf.EtIc<1H)H4$HAʉމELAILMcHHHHH)H HHIHHHHHH)H HHIHHHHTHH)H ILILHAHHH)H0B:I :H wH wI vH111DE.HhH|$HAt@tHH9uE)@HH[L]A\A]A^A_É<${LpLi $AŸkUHSHH=fHMwHSH 1H5U#eHKHS1H5jeHS 1H5~H!dS&1H5dHS(1H5H!dS.1H5dHS01H5dHS81H5xdHS@1H5adSH1H5KdSL1H55dSP1H5dH51HH#SQcSX1H5cS\1H5cS`1H5cSa1H5 cHSh1H51cSp1H58vcSx1H5?_cH5I1EcH51+cH5 1cHH51bHH51bHH51bHH1H H vH5ʝH1bHHH H 1CH5H1]bH51AbH51.bH1HH5 bffv4H5T1aHH5r1aSbH51aSc1H5aSe1H5aSg1H5jaH51PaHH5216aHH5P1aH []qff.AWL=AVL5AUATUSHH8dH%(HD$(1vHvIvH{InLLHaH;nLLHaLH5HaH{L-+mLLHxaH{mLLHaaLH5HOaH{ IL!mH5ݛHH'a{&nmH5WHH aH{(L!PmH5HH`{.5mH5FHH`H{0mH5HH`H{8lH58HH`H{@lH5HH`{HlH5~HHh`{LlH5HHN`{PlH5HH3`HH#{QplH5tHH`{XVlH5iHH_{\kH5HH^HHH H 1oHgl11LIH5mLH5H^HH1H H &Hl11LIHIlLH5xHG^IjH5mHH&^f(1LLLH )$)D$HD$ cLkH5HH]fA AfAv<iH5|HH]HiH5~HH{]{biH5HH`]{ciH5HHE]{eiH5HH*]{gqiH5HH]SiH5HH\H5iH5HH\HiH5HH\H8qH5H1r[ kHnHD$(dH+%(uH8[]A\A]A^A_Lhff.AWIAVAUATUS1HxH|$ HL$(LL$0DD$dH%(H$h1BHHDHD$H$pHD$HD$aHD$81H|$E_ f|$~ED_)$`HI/EEHzAwH DHcH>Df1D$_HD$`0xHD$hfD$])D$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$PE;HT$ HcÉ\$@Ll$`Hl$HLd$]L HTAFLHH@DEL1H H4`LL4eH9uNj\$@Hl$HL$`MH 7L1_H5SHDZHeIL;|$6H$hdH+%(Hx[]A\A]A^A_DH5THyZHt$ IHcHHDML LL$`H jL1C_NfDH58HZHHT$ L$`2D.D,P0PfDHcHD$ HDŽ$`L$`H $`P@f$d$fL$`H5ĕHqYHXHt$ L$`FbDNePFcPDFgH mjfDHL$ HcL$`DH L1^$@Ht$ HcL$`HH BTDLRDL1]ZYfHL$ HcL$`DH rHL$ HcL$`DH $/JLt$(MtL^eHLHWvH|$0HMHH1iG@H5:HHD$@WHcHT$ HL1Ll$`fft$|L1H )D$`IHD$pD$x\LZLT$@HAAHD$HAAAAA{D\$@HceLL$HD\$@IAIcfAt~Љ@ ~@aWHL$8 DAЉA sDAAa@WE8HcA Ht1-H[1LH$Yu1LH;)H51ۖM1H51迖1uUIUH51螖fAUATIUH[HAYDLHV]1A\A]ff.AWAAVAAUATUSHHHt$dH%(H$1OHSDHD$0HHD$ HD$(D$8@EC1D$<1HHD$@Hf|$XH|$ HD$HD$Pft$TD$VD|$WZDeAAH]D$ AAA E1E1AD+AED9CP.;D$ LDE)E&L}NHHD$H8HlLIvA'PHTH$dH+%(6HĸD[]A\A]A^A_H=KH H1D\$DT$YL$E1H=UKHYDCD1H=4KHsYD\$EC*AIHA fH=JE1H H YDEH=JH1XK1H=JH XL$ EǾ1H=iJHXE1DHSDLHH HD$pHD$`HD$hD$x@2CD$|1H|$`HH$H$1D$f$Ƅ$D$f$ XuvDe=DAH=IE1HE1Wf.AE1H=IIH rH;WH=)IAE1HZWH=HA1H ?H}.WH=HA 1H H}VCE18FH=HHw3H1V=PCE18~FH=WHHY3H1VuWC8PFH=)HH3H1cVff.AVfAUATUSHpH^LndH%(HD$h1D$`)D$@)D$PHIHMI$Dux1HLl$H$HD$D$@|$D$ Dt$$\$(D$,HD$0fD$8FuIDMLt$@!L!LHID$MLLMHDHH0HT$hdH+%(uxHp[]A\A]A^fHIHtHH]H=FA1H H{Tx9NfATHlE1HdH%(HD$1Ht$(t$(gPZYxH<$OH<$INHD$dH+%(u HLA\Mff.fAVAUIATUSHH5VMHHź1H7MHo@11HH ML3M~xL HIHLHHQHILHL9u[L]A\A]A^DL1E11H52[L]A\A]A^fDHE1K[L]A\A]A^1E1HL1H5v1LH51ԍH|KnHXfHEdH<%(H|$H1)D$ I@T$$HL$`AEA )D$0AL$0E )$T$,HA )D$HD$@$LT$DD$(L$4u"x1HWLHT$HdH+%(u3HXH=CA1H <HxRKff.@AUATUSHHXdH%(HD$H1D$  HD$ D$ 0HD$HD$?CD$$D$ DH|$HD$(Dl$0HD$4D$<LjD$=EAąu:L$ @wj@HHHDH5&1=DH51ڋHD$HdH+%(HXD[]A\A]H7@uHGH519=t$ {fHt$ fAąu |$ H5N1Ab@H֐'H=BA51H FHvEPIfDAWA'fAVHH5zAUE1ATUSHHdH%(H$1H$HD$L$P)D$ HHH$PDŽ$H$H6H$(HH$@HH$XH۬H$pHH$HXH$HHDŽ$ DŽ$0HDŽ$8DŽ$HHDŽ$PDŽ$`HDŽ$hDŽ$xHDŽ$DŽ$HDŽ$DŽ$HDŽ$H$HH$HH$HH$Hx+H$LHHL$ H$pHhH$H|$H"gH$H!gHAgH$HH$PHumH$H{H$`H$H5lH$HfH$DŽ$HDŽ$DŽ$HDŽ$ DŽ$HDŽ$ DŽ$HDŽ$ DŽ$ HDŽ$(Ƅ$XvDŽ$h Ƅ$oDŽ$DŽ$Ƅ$iDŽ$H$H$H$H5H$ HL$(H$HH$(HugH$HH ƽH$XDH$H{DŽ$Ƅ$0lH$pƄ$xtDŽ$DŽ$H$膏Ll$AątRMtAEpLFH$dH+%(HD[]A\A]A^A_@H=fHt$HDŽ$)$\$(Lt$ )$)$)$荏fAAMD$HHD$hHD$0@D$H@D$8D$XA}D$TD$\|$L1H$HH$H@f$HT$pHD$pHD$xH$DŽ$@$H$HDŽ$4H$HHD$@AEA}HT$0d;Aąum|$$HHHDHLl$f.I}=I}nHyfA}gLbf=;H=2;@E1Hr]IH5 15=1;z$H515= ;RH$H="jҪH$H$HHH H =:H H 1H H H5H1 5H 9:"H=3KH=:H= :E1H5H':H=9E1HHfH 9H=sJ fDAHa1GL=L%Un1H=O9ALLGAED$LD$TD$\H=9LL1AKGH=8A1H HmG@386H=8HѤH1F8AA}yH$bff.AWAVAUATUSHH $HXdH%(H$H1HLl$@ADLIHD$HECL|$D$$HLLl$HD$D$ 0HD$(HD$0D$8D$<`3AŅ$E1;HH\tn;CHT$LHD$HT$D$ 0D$$HD$(HD$0D$8ft$<9ŅbL$BAL1FŅ+{LD$DL?AEHD$H\$Aąu)@A9HcHA)tIcHމ4yۉ;H|$*?sGH$HdH+%(HXD[]A\A]A^A_AL1AOA8H=h HH1ff.fAWAVAUATUSL$HH $L9uH(fdH%(H$u1AH$HL$DDH$DŽ$HD$hDŽ$,ALLHDŽ$)$HH$)$`HL)$pHH XH$)$H$H$,H$$HHH|$hƄ$tH$HwwH ˖H$H$H$HowH$H H$HH$(H?H$HH(/H$`H$DŽ$DŽ$Ƅ$ dDŽ$0H$8DŽ$@Ƅ$hvH$HvH$H$IHD$XHl$hAŅL$H$DH$DI$t'fHIAT$I$uL$H5=L!H5svL NH5`vLoH5MvLH5CLyH5uLD$0 $tHL$PIؿ1H5xHl$hHtEHH$udH+%(vH(uD[]A\A]A^A_D$0H$XHH.wH$HD$PHD$hD0ExP1H$4HDŽ$HH$4DŽ$0HD$(H$HH$H$HHD$H$HDŽ$DŽ$Ƅ$ AŅH$4H$5HT$8fHH9t8 tLL$8A1H$@H H!1H$0 H|$pHD$pH@tHH\H$`HIHD$`HHǹ$UL1$H$H$L$HD$PHǹHLO1H A\A]~HD$@E1H$D$0 t$0!H}D$0 t$0$Hl D$0$Eu H$HD$$LL$XHrH$H-8LuHHD1H|$1IH$IH ZHH5gu1H$H$u@H\$@H$^ $E6Hl$hEWD)3ED$0H}H}N8}Q+D$0Zf1H$51۹D$7E1)$4HH)$H$H$e)$HDŽ$ HD$ H$)$)$@AH$DD$DŽ$(D@H$1HxHHǀHH)1HDHH$H$HHD$a AŅo$eD$0e$HH\$(H$DLpLH1H1AD$b$ef! f f$eD$7HHHTfDHt$ |$HH H$Dx H$DDŽ$DEHT$$$eAH|$茶AŅ? DAA 9%DAƒA A9|$7Y$EE1f1HDŽ$ H$5)$4H)$HH$H$eHD$ H)$H$H$D)$DŽ$)$NpH$HHD$GAŅO E|$0OH$1Ƅ$HL$0H5`pHDŽ$HLH pH$H$H$$HHt$LHspH$H5%pH$8HYH$H5pH$XH[H$H5 H$xHmH$Ht$(H$HH$HpƄ$HDŽ$Ƅ$Ƅ$Ƅ$HDŽ$H$Ƅ$Ƅ$PƄ$pƄ$Ƅ$H$HDŽ$豸1HLu$EH I9uދ$$tCHl$fDLUHLҶu$EH H9\$uۋUHuȋ$4H\$8t#Ht$L蓶u$EHufHKHDŽ$)$H$H$DƄ$ D)$)$ExE1H$ H H$@HH$HHHDŽ$ HDŽ$(HDŽ$0DŽ$8@$<H$PfD$XmE1 H|$xHc H$H$H$D0L(H|$(1`f)$$H$4H$7H$ F)$%HDŽ$HƄ$$HƄ$%H$ 5HD$HDŽ$5H$5H$H$6HƄ$5Ƅ$05HDŽ$@5Ƅ$P5HDŽ$`5Ƅ$p5HDŽ$5Ƅ$5HDŽ$5Ƅ$5HDŽ$54Ƅ$5HDŽ$5Ƅ$5HDŽ$6Ƅ$6)$)$%)$ %HDŽ$ 6H$6HJH$6HcH$6H`H$7H}H$87HH$X7HkH$x7HlH$7HkƄ$06HDŽ$@6Ƅ$P6HDŽ$`6Ƅ$p6HDŽ$6Ƅ$6HDŽ$6Ƅ$6HDŽ$6Ƅ$6HDŽ$6Ƅ$6HDŽ$7Ƅ$7HDŽ$ 7Ƅ$07HDŽ$@7Ƅ$P7HDŽ$`7Ƅ$p7HDŽ$7Ƅ$7HDŽ$7Ƅ$7H$7HjH$71HDŽ$7Ƅ$7HDŽ$7 2fDHCHL9u$EH H9HCHu;)f1AnH$5)$4HHAssertLo)$H$$HH$H$eHD$ )$H$H$DDŽ$$g.bifD$$D)$HDŽ$ DŽ$)$EVpH$HHD$詮AŅ^EH=zhL'AŅGH=υ6H\$@TLAŅ1H=Q @A|$7EH=g"DD$7f$ef"H58f1$eH5/f1$eH5'f1$eH5f1$eH5f1$"e1$#eD$ eH5eD$!eZ$$eH5e1@$(eH5e1&$,eH5e1 $0eH5e1f$eH$4eH5e1$LHCL;<$uHH5H1HfHD$ x3Hl$ Et_uH}iH}H~|$ H$;H5~HH9ufD}HD$ L$H5wH$L$H1H-W#H=\W'HS H1H I9u H=&L1HR`Hl$ Et]uH}fH}HD$ H=Am1H Hq}hATAHUDSHdH%(H$1H|$XLD$PD$HH H|$D$XbHD$PHD$H dvHD$pH4H$4Aąt,H$dH+%(`HD[]A\fDHD$ xHT$|$,HHD$0HH$HD$81HD$HD$H\$ D$(@HD$@fD$HAąug|$tpH$;H5H-H9uHD$xKHl$EtOuH}H}H~DHH5Fu1똋}H=A11H H`AWAVAUATUSHH $HhHAL-dH%(H$1H$`AHHLD$`DHH|$`?H$pHHQDŽ$H|$HD$`H$hH }tH$HTH$HXH$H$iH$HSH$H'H$H$jH$HSH$ HsH$8H$kH$XHSH$hHH$H$lH$HSH$HRH$HQƄ$D$heƄ$dƄ$rƄ$@wL$Ƅ$tDŽ$DŽ$Ƅ$oH$H$pH$HDŽ$DŽ$H$0Aąt,H$dH+%(HĸD[]A\A]A^A_HD$DE@L$pH$x$`L=1!$l<t$jH|$H$d$h$ifHT$H|$ HT$ $`D$8D$@$dD$HD$(D$P D$08T$4D$UD$VÅD$xEu)$d1D$hH5Kr$j$k$hHD$H|$ HD$(HD$ $`D$00D$4$dHD$8HD$@D$H D$LD$M~Aą3$xSDD$$dH5q1HD$xXHl$EuH}H}!H@$i?*H H=pT$k6H H=jpAH|$d$`1E1D$DHL$HD$H$lf|$TH|$ D$V$dHD$ HD$(L|$0D$8@T$ H1,L ]DH5 D1@HރDAHA  uAfDރDAHA 辉?uAރDAHA莉^uً$tA H^a$tA H_9$9A H` |$HHH5HH`H5 H1HB ~HhfEƄ$DŽ$H$H5#KHHMH=aA1H 2xHC  H=0Ⱦ1HJjHl$EtSuH}pH}HAxH=L1HEHl$Eu}뺺3H H= kUDAWfAVAUL-VJATIUSHdH%(H$1)$H$)$H$L6H$1H$HH H kH$HH$H$@H$H$PHH$`HlIH$xHH$H H$H$H$H H$H,IH$H$H$H sH$HIH$LH$0HDŽ$Ƅ$DŽ$HDŽ$Ƅ$Ƅ$gDŽ$DŽ$Ƅ$cƄ$8dDŽ$HDŽ$XƄ$jDŽ$DŽ$H$H$H$HjƄ$sH$9LD$- $o $ Hc29I[HDŽ$& 1AL$PL߬ LHT$`H$LH$A H=3>HI:IG1HD$XfL$H=E1H)`zf.|$HL$8AQ C@HT$ HL$PIH$H$Hz%DH$1Ʌ@ HT$`H5=H9F$H hHL$pHT$`H5=HDŽ$XHcD$ 1L$L$ ID$L=HI\E1H݋$EMFLIc1L IA HD9L<D$H1L$AUH="H_D$D$H$IXZfHL$8A Q fDHD$@DŽ$@H=H[1D$$I<$D$OH$;$H$HD$pJH$H$H5[:DH$HH,H$HX H9LL$IAMAAȁPMDCAM HH9\iH$H5D:HHoAuMu E1@HH$LIL)LH9Ao)$PAoV)$`IFH4H9r|$VuoEH$L%~)HA+wDH5}HL$HAAvHLx+@H bHcH>衾LHH蓿AEI I9*fZLHHb̓H?nLHHA묾iH$H=5IHcY1t\$H H=27L%E7}] PH$H=IAHY1HD$&H$LfWfLL=H57LHH$HhH5s7LHJH5f7LH,H5^7LHʽH5V7LH謽'H5O7LHI蒽fA?IcLHL9uH5 7LHHIRf;H$LHIH9uH=A1HW|\$>8+HH=H51>\$xljD$L$1H=H1 DD$DD$@D$ĻDD$8ADD$觾DD$HH=xH41DD$DD$DD$L$H=FH7X1lJH LH55HH кLH5 5H辻L豺LH54H蟻LH5ULHHHwA}IBHHgL9u6H HD]A\A]@H|$Ht$ AąD$ 1HHD$H轼HHHHH訹AąM$$Ѓ0 $H2 |$ H H5#1ZDH5|1H}׮H}nf}hHD$HOf.ۼIбHH5yLާLaHH51蛦 L9@ۦ8!̩HH51{H5ZF1AH5lF1h!HDAWAVAUATUSHH $HfPL%L5mH-'"I^0<$L$pL$ Ht$LH5vmdH%(H$1)D$@)D$0)D$PHD$(Ht$8Ld$@HH LD$LdHD$P)$ )$0)$@)$P)$`)$p)$)$)$)$"fPHLI輰I6PL謰I9uL$pLPLHخLcx@PHLHlHsPL[L9u1uH$HHݱHT$HƄ$eH$HD$0H DH$H H H$H H|$(H$HD$1H$(Hr H$8Hs H$PHD$@H$pHc H$HjH$HD$8H$HH H$H6H$H 7 H$HuH$(H DH$H$HT$LƄ$dƄ$XsL$`DŽ$hDŽ$xƄ$tL$DŽ$DŽ$Ƅ$rDŽ$DŽ$Ƅ$0fH$8H$XH ~H$pH CH$H H$H jH$H yH$H CH$HH$pH$0H ]H$HT$PH$HH CH$HT$XH$xH 6H$ HT$2H$H CH$hHT$3H$H H$H$H$H uCDŽ$@DŽ$PƄ$xwH$Ƅ$TDŽ$DŽ$Ƅ$VDŽ$DŽ$(Ƅ$PDƄ$LƄ$vH$H$HT$H$4$HH$H$IHD$DŽ$ LD$(AątPMtAPL߮H$dH+%(HĸD[]A\A]A^A_A0A@D$D$T$L$pB}EHT$@HD$E1IIRH+~J4Ht|$uHH$fH$uDLd$8 MD$E1T$IIHgD4$J4Htހ|$uLOfuDH$Ll$ D$D$D$HuI}HIHHHuA}8IihLl$PH{gHMHD$LpII6HtuLL$eHcL$uLc$1҅tFLc$HgqL vHsIihHH;J<D2HH9uƒt$Mih|$2D$p8HD$`HD$h HIH fHD$xIƄ$HDŽ$L$3HDŽ$Eɍ   H|$`fq 1 f$f% fËD$\$D$tD$X$輱Aą_|$0D$1D$$pfH$)$)$HDŽ$Ƅ$DŽ$8$$Ƅ$)$'Aąt)f.D(LD$(.fD$H$1HH$H$HS㥛 Hi$@BDit$H@BH$HHHHHH$I9nE1TDLLH)H)H9HGڃ$vHH51m6L.bH$I9vcL9aAą$HcD$LLHHiIa$H$HH)H9VHI9w$usL`LAa|$1udEIxL$[L$IxL$DAxL$L$f.|$1=$D$vDH51=$pH<$fA)$HDŽ$)$DŽ$8$D$Ƅ$)$迮Aąx7$vDH5F1貚H=趬y8OHH51J͚8/辝HH5<1nE1F_Ϲ~H5<1eLD$(ADLH5<1:LLH5{<1H=A)1H >H.D$H\$L$LHsSIHH[ LpL3Mt#LǺH*LHIHI9uLLH59;1eH5;1MHxfH//xvJAdL=12HH59薘oH=HoZY|g,ȃ~}c8HH=<QL<WA҃2RHlA)DH5HD He1H V@1ɋHL u<A1QH56Ѓ)HHDH 1D蘗XZHG1fGGfG1f.TFHHu?u DAWAVAUATIUSLH8LL$pHL$DD$L$LL$Ll$xHt$(L$HT$ H|$(MH该H5IHHH|$ 蓥H5gHHїH|$wH5VHH赗|$茡H59fHH蚗HBH5-HH耗H|$&H59HHdH=H5HHFL莣H5`HH,LtH5OHHL躤HH5OHH8HL[]A\A]A^A_ff.@AV@MAUATAUSHPdH%(HD$H11D$@IHD$|$D$ t$$D$,HD$0fD$8fDIA9v+D@LLt$)9HG؉H$\$(诨tHT$HdH+%(u HP[]A\A]A^fATULSHHdH%(HD$1yuXAHcHT$H5H<1d|$t D$1lEHD$dH+%(u HD[]A\H=/A+T@AUATIUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$$HD$HD$ L-{D$0HD$BfуHL$$HMtL, HHIăt\LL輥HHtdHUHPti 1Hң$/vHL$HQHT$f.1HT$dH+%(uCH[]A\A]H=5DHH51貒趟fDAWAVAUIATMAѺU͹ S HdH%(HD$x1L$L|$HAPLL:MY^H|$$H1ATA LH|$XZH|$HcLd$0HAA@L@P1WLAWјH LL01LH5蒑HD$xdH+%(u)HĈ[]A\A]A^A_D$$+INFH|$$D$(ad@AWAAVAAUATAUSDH8H|$Ll$DD$dH%(HD$(10H|$Ht$(HD)LfDHPH9uH DћH5HHߑA@Bw 1ADLLbH55yHH蠑A@Bw 1Aƒ|$t_D$+INFD$"LH5ǍHHX衝H5HH?HD$(dH+%(uH8[]A\A]A^A_DLff.AWAAVAAUATAUSDH8H|$Ll$DL$dH%(HD$(1螥0H|$Ht$(HD)LfDHPH9uH虠DaH5rHHoA@Bw 1ADLJLH5wHH0A@Bw 1AƒtaD$+INFD$"L謝H5YHH|$H5HHϏHD$(dH+%(uH8[]A\A]A^A_DL莛ff.AVAAUATAUSHcٹ0H dH%(HD$1Ll$Ht$LD)HPH9u H5v1A@Bw 1ADLL5n LL1č@Bw 1ҁAtfD$+INFD$L L1肍 HQHLH5{ 1^HD$dH+%(uH []A\A]A^ÐLV?ff.@AVAAUATAUSHcٹ0H dH%(HD$1Ll$Ht$LD)HPH9u H5bu1跌A@Bw 1ADLL5m LL1t@Bw 1ҁAtfD$+INFD$L L12 HLH5t1HD$dH+%(uH []A\A]A^fLff.@AWAVAUATUSHcIHH9LD$HGE~zHAA.A)߸]4IcH9HG؍](E$E~A1HDAąuEE~U$Ht$DAąyH= E1HD[]A\A]A^A_HM$H=BH#.AWPE(PDM01DE4pH f.USHXdH%(HD$H1HL$H$LD$D$@ugGD$HHfT$8HD$(1D$ \$$D$0fD$4@l$6D$7HT$HdH+%(u6HX[]H=dA,H W.HH薝mAWfAVAUATUSH8dH%(HD$(1D$ )$)D$ IAI1A.lf.ID9tSAMA<^ACϙHc҈ uHI&LH{fD$ )$)D$D9u<$u&HD$(dH+%(u:H8[]A\A]A^A_HHcLHH -,H5H=耐AUATUSHH $HfdH%(H$1IIH|$IH)$HLH 2-H5L~HtsHHھLH胞H9tNH=gM1H H蚛Hu%H$dH+%(uBH[]A\A]@HؓH=L|L1HtB軔IGff.@UHHHL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1H$HL$HD$H|$HD$0H`ZD$HD$D$0HD$ ixEH|$HtD薕HH5wHԇH|$躔HD$(dH+%(u!H]ÐHD$H=jK脓H SH0dH%(HD$(1H|$HD$HL$ Ht$ HHT$l$H9u {oH1 U @*H ك uL H(1HLq/(<$H蹌ZLUY~I؃'HD$(dH+%(u5H0L[HHHLLxZf.AUATIUHHdH%(H$1Ll$H HH1 H5{H耉uLH1tdL՚HL$HT$ HH51zHHD$HL%PDL$1芋LHϘY^u)H$dH+%(uJHİ]A\A]fHHHD$LPDL$1 XZAVAUL-ATIUHHdH%(H$1I֙L꾀HH1豖 H58H=uLHt问H鞮H镮H隮@HXdH%(HD$HttHfHD$8@t$8HD$D$D$(H$HL$D$@D$$T$(HT$HdH+%(uHXT$(HH@t$8H$HD$HL$D$@|$HD$ D$,HD$0D$9蠂fDq詊fHXdH%(HD$HtdHfH)D$)D$ HL$D$@D$$T$()$)D$0HT$HdH+%(HXfDT$(1HHD$ 1@t$6fT$8HH$HD$HL$D$@|$HD$,fD$4D$7蚁vDg衉AVAUATE1USHdH%(HD$1Htp?tkH-MdHAIH踎HHu/FfDJD1HE薎HHt&IIt1LLJH$:tAHD$dH+%(uHD[]A\A]A^AWAVAUE1ATUSHdH%(HD$1Ht{?tvH-cHAIHIHu7Q@H9wnBDH1E̍IHt)IIt1LLH$:tAHD$dH+%(u@HD[]A\A]A^A_fL1AH=)H˳mfDATAUSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1Hl$ H=H|$ HDH$H=EHD$HD$HD$0D$0HD$ ^u|$ uQHHHtHT$H5\DPHD$(dH+%(u)H[]A\H?V腆DHXdH%(HD$HtlfHHD$8D$(t$(HD$D$H$HT$D$@D$$HT$HdH+%(u|HXDHT$HHHD$ 1t$(H$HD$D$@|$D$,HD$0fD$8{}ft聅HXdH%(HD$HttHfHD$8@t$8HD$D$D$(H$HL$D$@D$$T$(~HT$HdH+%(uHXT$(HH@t$8H$HD$HL$D$@|$HD$ D$,HD$0D$9p|fDqyfAUIATAUSHHxdH%(HD$h1脌H|$ HcR|AEHl$1H}HHEHDžHH) HDAE!I}fHt$ H)D$0)D$@)D$PHl$0D$8@D$DHD$HDd$P)D$ 2}H HHHHQHHT$hdH+%(Hx[]A\A]@A}HT$ HHD$@HHD$H1HD$ HD$(Hl$0D$8@|$I$RfDCI$1ɾ5HV;v rDEHD$I{s@C@UKATIUHH= dH%(HD$1Ht$uk|$udHHHt/HT$dH+%(uJHL]A\HD$dH+%(uH]A\NH8UAI˹fIH5HAWAVH0L0AUATSH HHdH%(HE1Hk)HH1HHPHH8H`HH HxHH=HH H0HDHHH@HDžHDžHDž ƅ8vDžH ƅoDžDž)))HH +HHHHHH tHHtH(H%H8H 1HPHRHpHHH ;HHq^HHHHH`HHH HHHƅODžDžƅfDž Dž0ƅXpDžhDžxƅRDžDžƅnDžHHHHHHH HHH(HCHXH RHpH5IHHHHCHH :HH5)VH HH8HHHHHH0H UHHH5Džƅ0lDž@DžPƅxmDžDžƅ2DžDžƅ3DžDž(ƅP4HXHhHHHHHHxH`HH iH@HHH=SHH5\HHTH H ]HH HHH0HPH=2HhH5{HxHH*Dž`Džpƅ5DžDžƅ6DžDžƅ(7Dž8DžHƅp8DžDžHHHHHHPHH`H HH THH!HH==HH5ԛH(Hd~H@H vHH"HpH=HH5uHHjGHH H8H#HHH=,HH5SHHH-ƅ9DžDžƅiDžDž ƅHMDžXDžhƅbƅsƅ dH`H .HH$HH=HH5HH&HHHHLHLH HH8DHXH ƅhrƅwHƅTƅ@tDžPDž`HhAąAt ƅ$E11ۨtƅ#AAH?DHHt?t1BAŅAE1HDžx- "1H}uDDtp lhd`\XTPLHxHPEAHLDPPtAWPpxPlPhPdP`P\PXPTP&zHp1HAQ|ޛ&HNEHH5pyH DH= nHH)HD؀H!HD1I&|#ifLvA~D~~ ~HHHt=Hf.H I^+H=CoHfH|$hfHl$pEtZt=HfH$dH+%(HĘD[]A\A]A^A_fH}7`H}j@}nfDH5.LhyH5*LhH5?LhH5Lh$H5Lh%DŽ$1HD$poxHt$hNLt$hD$\MH$H H51WH|$hH$E1AH=Lɮ$HRH1H0|$1#HHT$dLIH$Ht}D|$dDŽ$D$HD$p0xDHT$\AąT$\H51VfDfDH [1H=AlT@NHf.L$M LGZAƉD$`LfLLHHD$h_HD$pDd$dH\$hD0Eb@D$HD$xE111HAhhSIH IH|$Ht$xHGHDL-1H5L%lIAFLH5IEԿ1IAFLH5IEԿ1I H=NE1H\)H N+H=)_wAEA1H=cNH|1\H=DN1H\1}\H$1AH=NHI\H=M1He(\H MH=^L~VH8LL=D$ `D$D$`D$LH=vMHg1AH p1[yH EMH=)?^HHLX=AH= ML11H A[D$TH LMH= Hl$(I]E1:H=0Yy|H L)1H=hA}]#H=l0T$yT$AH=K0L$xL$D$qH L#1H= A]H K*H= E1A\'E11H KH=[ A\H=/RxD$H K-H= Ax\3H=g/xD$Hl$(*H 3KH= A,\*H KH=W A\ff.@AWA-fAVH AUATUSHdH%(H$1H|$P)D$0)D$@HD$XnHL$PDHpD$hHD$PH4HD$`HD$0HD$pH H$H'H$HnqH$HD$8H$H H$HH$HH$HD$@H$HD$xƄ$dDŽ$DŽ$Ƅ$tDŽ$DŽ$H$HpH$(HAwH$8HD$HH$HHpƄ$0vDŽ$@ H$X#D$tH|$0H-*IfL|$@MRLHLH=aHø H9HFHMHH LH=[zH9HFH'H$AD$HHPBЉ։H4SIH@HL11LtJZHD$0HHD$(HD$(HD$H*HD$Ht$H|$QJHH;tLKIHtLPfDLLIIHtULEHH"SuLC@HDH2HLGJHHuE1DLLLpHD$8Ht~HD$(HD$(HoHD$H *HD$CfLH޺FLAID$ELDLVHHLD菔Ht$H|$ IIHuLMH$dH+%(YD$H[]A\A]A^A_E1L|$8MHBH= WfA8HÁDH=nFIL1HoT؉D$PcA8HÁdQDH=*FH1HydT-A8HÁ5DH=EH1Hm.TL]LLH%H= VD$E1LHH1SKMHpHpHpHpff.UDHAWAVLHAUIH5jATALSHojH dH%(HE1HjƅH81HH*jHHHHjH@HHTHDžHDžHDžHDžHDžHDžHDžHDžHDž HDž(HDž0DžƅƅƅtDžDžHHfiHHNiHHmiH0H@iH`HDiHxHxHHHH"iHPHHH.iHH5xHH@HHHHHHHiHƅnDžDžƅ8aDžHDžXƅsDžDžƅwDžHHDžƅfDž H8H5ShH(HHPHLhHH5wHpHHH)hHH5wHHHH hHH5wHH H(HXHXH5xH`HHH8HHH(HpHgHDž0ƅXqDžhDžxƅIDžDžƅSDžDžDž@DžPDžHH5(gH HhHHgHH5OwHhH gHH0HHfH0H5OwHHlHHUnHHHUwHxH5fHHPHHHfHH5~wDžDžDžƅiHDžDž(ƅPWHXDž`DžpƅPHDžDžƅQHHH vHHdH@H eHhHXHH\HH vH HvHPH5eHH`HHeHH5vHH eHHeH(H5eDžDžƅ(kH0Dž8DžHƅpcHxDžDžƅlHDžDžƅFHDžDž H@HpH`HHH dHHHH dHHH8HHH LvHHHpHdHH5uHH HHuHH5dHHHHHqdH`H5vHHHHSdHH5PdHXH IdH HLƅHTHPDžXDžhHDžDžƅDƅhgƅGH8HhHHHH4HHBHHcHH8HHuHHcHHH0HcH@H:THXHHxHWHHfHHHHHHVHH<HHHHHƅCDžDžƅJDžDžƅvH Dž( ƅ`RƅMƅOH0HHPHPƅ8UH`}LLHLDAą-H8H5b:FH=:FC=;E5:JEIH>H8H/9ELMLMHHHE1E1L>HHHHtH;H1H/>HHHLLHH@HjH>HXZHHHtH#>HH0IH(H ?HHp@tFLD=9tFL><@HDž8VE1E1u=_9uL?LALAHEdH+%(HeD[A\A]A^A_]E1E1E1DL<11L:"38HÁ6H=8H1H`FBf.{38HÁe6H=>8H1HrxFD#E1E1A+38HÁ26HI1H=7H!FD#AfD197HHIHtkE1H`{>AfD28HÁ5HI1H=R7HEk@H186HHIH#28HÁL5H=6H1H$E==+=E=1E1aH 64H=GE1A^H g6:H=aG>HaHaHaHaaHvaHjaHaaHUaHIaH=aH.aHTaHHaHaH0aff.fAWA$fAVHAUATUSHdH%(H$x1H|$P)D$0HD$@HHL$PDD$XnHZD$hHD$PHHD$`HD$0HD$pHjZH$HH$H \H$HD$8H$H!H$H\H$H[bH$HD$@H$H[D$xƄ$dDŽ$DŽ$Ƅ$vDŽ$ H$D$hH|$0H=4D$@PBЉ։C4>IHBH811L5;HD$0HD$HHD$(HD$(E1H$HTHD$fDHt$H<$5HH2;tL!7IHtL<fDLL4IHLI1HH~>uLb.H@HLA5HHuL|$8MHBH=CD$DLp9H$xdH+%(UD$HĈ[]A\A]A^A_-8HÃt0H=l2H1HiZ@؉D$HT$D1H5^,HD$8H[HD$(HD$(H=ZH$HHD$fHt$H<$4IHLH61LAIEELDp5IHtpLP:IHtML,(fDH09HL,8/H=0IL1HO?E1LL58+8HÁ'.H=0H1Hj>Z7S7I7l8H[H[H[ff.U HAWAAVHLAUHIH5ATLSH]H8 dH%(HE1HXH UHDžHDžHDžHDžHDžH;LHDžHLHTHDžHHTH dHHDžHDž HDž(HDž0HDž8HDž@HDžHHDžPDžƅtDžHHH H)TH8HTHhH0THHTHHTHHcHHSHXHHHSHHH@HSHHHHHHH HXHSDžƅ@nDžPDž`ƅaDžDžƅsDžDžƅwDž(L0Dž8ƅ`fHhHH SHxHHHSHH bHHHHRHH bHHH0HRH`H bHPH HxHCHH bHHH@HHH(HHoRDžpDžƅqDžDžƅIDžDžƅ8SDžHDžXDžDžHHH QH8HHpH 'bHHHHQHH 5bHPHQHHHH0HHQHH bH(HYHHQHHHH`HHH(HZQDžDžDž Dž0ƅXiDžhDžxƅWDžDžƅPDžDžƅ0QHHH maHXHHH aHHHH aHHHpHPH H aHH{PH0HHHmPHhH aH8HHHHHHFPHXDž@DžPƅxkDžDžƅcDžDžƅlDžDž(ƅPFDž`DžpHxHHH OHHHH OHHH@H `HPHHH `HHHHGOHH `HHKOHHH HAOHH `HhH4OH(HHH#OH`H ,OHHOHHHHH@H5NHpHƅTDžDžDžDžƅ(DƅgƅGHHHpHHHNHHNHH'HH2HHgNHHgNHH HHXHH5HHHHHHHNHH5,NH8H &`H HNHƅCDžDžƅ JH(Dž0Dž@HHH`ƅhvDžx ƅOƅoDžDžH8HHHPHXH0`DžPDž`Hh87LH~=LD裝HDžtNHR,H@f.H8Z.HEdH+%(He[A\A]A^A_]fHXH}wÅ"HHHtH59M{0H$%uEHH%HHLMH5L30HߍFC=%E5$G/HHHPHt HHHHH #HoHy(11HM&ÅHHH8L@H$H@H8H(IHHHtH%HHHHHHHHHC'IL=GfML,DLL %IHL -HHHtHt H}.uL/HHHtHt HU.uL9HLI%fDL1LHH.tBHH5K-t+H8fxcxLX"tm8t`L$LH+LI+LH=1"HMH^1h0E‰HLI$HMzHHHLHyH0DžHDžf.؉@HL&I|8iH=B!H1H?I|/sH5 I1jHDžJHH`LH`HHhHHpHHxHHHH_IHt_H%(HtRuIH p H=j1ur= ]؉HLLHHHH$IXZMHHtLS$H0H(MLH slLLLHW,A+uLHH0H LЀ=؉L'N=l HDž`Hb$؉E8HÁH=H1H Y -LMt/H5BL)t2H5FL)HCHDH]%HpCH# ;1_H=8H1H'r,%;$Hٺ3H=x/:%Hٺ-H=%.HIHIHgIH[IH\IHUIHIIH+IlIHI`Iff.fHHHti?WvDHDA H~y V VD)y pD)ƉP pP Q) P$H51eDHS㥛 AVAUATIUHSHdH%(H$1HLt$Ll$PHHH|$LH?HHH)H\$Hip-LPLH) I1MI)H LHH$dH+%(uHİ[]A\A]A^#ff.AWAVAUATUSHxdH%(H$h1HDHfHGH$D'HIH5:3F )D$`)D$p)$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$PHHFHHHcHHN@HHHLfDHH9A9uPLl$`H@HFpLDL$ HH4h)DL$ HMcMEL%IML1H GL(MLH >HF1k(DCLLH :1AI(DCLLH 61AA#(DCLLH a1A(DCLLH 1AA'DCLLH 1'DCLLH 1'H4$LLH= pLNH=5c0*H$hdH+%(Hx[]A\A]A^A_Ll$`HxDL$ Ld$L=)DfLI1FfD$TL1)D$)D$ )D$0)D$@D$PL"H5wLHML!H5sLH3DC1fLfT$TLAF1)D$)D$ )D$0)D$@D$PL!H5.LHDC1fFL1AfL$TLA)D$)D$ )D$0)D$@D$P7L/!H5LHmDC1fLFft$TLA1)D$)D$ )D$0)D$@D$PL H5LH DC1fLF1Af|$TLA)D$)D$ )D$0)D$@D$PqLi H5:LHE1fLfDD$TDCL1F)D$)D$ )D$0)D$@D$PL H5LHHDCf1E1LFLfDL$T)D$)D$ )D$0)D$@D$PLH5u LHL$ H$LH5rkMLH!fH-HD1HHpL1HH5SKH1H6KH1HKH1HKH1HKH1HKH1HP H4$1LH=mkH=9_!H$hdH+%(u$HxH5-G1[]A\A]A^A_]SL5,IщMtuI@hHHcH~^Ip`HIIt @HH9t;P9u9uPH@I@pI4suHt Au-HIyHIHLILI)DL)HDfADËADADff.AWf@IAVMIAUMATUSH8dH%(H$(1)D$ )D$0)D$@)D$P)D$`)D$p)$)$)$)$)$)$)$)$)$)$M1D$$HD$fL$f1D$fT$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$)$MMMjH\$L% KH$ DELH߾1IHHM9uHlH5DLH |$oH$(dH+%(H8[]A\A]A^A_fDMMMrH\$L%[JH$ @ELH߾1IHHM9uL%Q1ILH DLa|$GDD$L1H BHC3LLLD$ H C1$Ht$LH=C~gfAzH=J(J $IJ f|$HL$HT$ D$fDD$1fHH e~Ff$d1)$ )$0)$@)$PDŽ$`H~H5@LH H|$ bLH5BH $HT$LH5B)e@MMjH\$L%tHH$ DELH߾1IHHM9uHH-f1H3BH |$bL$H&@H5B1 HL$ H1HB $Ht$1H=Ae D$ff.fLe&IщMtuI@XHHcH~^IpPHIIt @HH9t;P9u9uPH@I@pI4suHt Au-HIyHIHLILI)DL)HDfADËADADff.AWAVMAUATUHH5eSHH|$8Ll$XHHT$LHL$dH%(H$1HD$PHD$X*H|$XHD$ MtH|$XHT$XH5L LH5!HH BHL$LH5HH|$Xv LH5HHD$@H|$XM LH5uHHD$0D$HbD$(HT$`H5PHAHT$PH5GHD$L)rH|$PgHHHE1Ll$pfH|$PLM HICDMvL9uDl$pH(IyHTlHD$tDHH9u/H|$HD$HT$Ht$ H|$LkH|$PL Ett\$0Ld$ E1Dl$HL|$(\$1AH\$8DH|$AIHD$LL,*E1LLHHVDt$D9|$HuLd$ L|$(H|$PLL H$dH+%(}H[]A\A]A^A_AEtL$LLd$@Hl$@Hl$8 D$(1Ld$D$(D$0Aހ|$(HD$0txHL$iuAnuAt1ɋT$HLD$hLHHT$hAH|$HK HLd$0A9|$(AuIHAH|$H H|$`E1H~H\$LIH|$`HE1LLHHHHL9uH\$lH|$@L|$hHD$LHEH=f HT$H1RLD$0HXLZ fDHt$ H|$@H|$X^HD$@H|$XfD$(UHt$ H|$fD+H|$Ht5Ht$ H|$HH\$DHt$H|$yH|$HgDHH=^HH1CHH=4HPH1nHH= HH1DHwH=HH1HMH=HH1H#H=IH1l7DǿDD A9wAff!‰*XeD*Yf*X,ff.@USHH $HHdH%(H$81HGD$Hl$0HHH$Hl$D$0HD$HD$ D$(D$,uH5HF1҅NˆH$8dH+%(u9HH[]H=)A H H ;[J ff.USHHXdH%(HD$H1Hl$IH Ht$HDD$$HL$8HClD$ CD$(CD$C D$CD$CD$CD$0C HHHH?HH)щK$HD$HdH+%(uHX[] ff.AWAVAUATUSHXt$ L$DD$`dH%(H$H1HHt21H$HdH+%(HX[]A\A]A^A_[ H$fH1H|$HHDŽ$Ƅ$HDŽ$Ƅ$HDŽ$DŽ$1;HDŽ$f$Ƅ$)$ HC1ۃ|$ HD$hcH6L$Lt$E1H$HL$HD$HncHD$ HHD$(H$HD$XHHD$0HHD$8HHD$@HHHD$HHsHD$PL|$`fIGH$A?Ht$ HH IOHLHo^M<+ HHHHHiIHH)HHHHIHHHHH)кdHH)1QHL$(<XLZ2 H5HHpAGHt$(HHWH|$X Ht$0HH=H|$` Ht$8HH#A Ht$@HH A!Ll/L Ht$HHHEG"H=hfEt*H$H ֫ 1H|$]H|$S Ht$PHHHH4$H1P 1fDAD9l$ L@HD$hIN<IGIH$EHH--------HD$`H@H$1 ;H|$HH=Y H= H=; H= HC1ۃ|$ HD$XHD$H$HD$(HT3L$H$H)L%)HD$ H$L5)HD$0H)HD$8H:HD$@HHD$HH)HD$PHlHD$
1f.H5#1HT$hHL$`HL$`LD$hHH|$HHIHHGHHIHLHHHH)Ho^M<+ HHIHILHLHL)A)HHH)HRQHA)H Pd1H|$ AXAYH4$HT$1L1DH--------HEDDH5l"1HT$hHL$`LD$hHL$`Ho^M<+ HH|$HILHHGIHIIiH)HHHHIHHHHHH)HH)QfE1|$ H+L$1H$HWL$HD$ H9HD$(H$HD$XH(HD$0H.HD$8H^HD$@HɒHD$HHL|$xAHD$PFH52HHIIA}iHt$(HHyH|$XHt$0HH_H|$xHt$8HHEA}6Ht$@HH+A}7L$LHt$HHHEE8H= ^fEt&L$H  1LLyHt$PHAHH8H4$H1u 1fADCAD9|$ ELLHHHH| .HL$hHB&HT$pH$\HL$hHEHT$pHB.H$Hy HL$hHt$ HHHL$hHHS㥛 H#yIIIHIH|$|$`HIHHHHHIHLHHHH)Ho^M<+ HHIHILHLHL)A)HHH)HRQHA)H|$ dH 1Y^H|$H5HHS@H--------HD$xH0IHHo^M<+ HLHIHIIiH)HHHHIHHHHHH)HH)Q=fH=DH=-8H=,BS HCLE1DAf9H@AuE1@S HCLE1DAf9H@AuE1@1f1H ?H=ѻmff.fHt)ttD3fD.-H W/H=fQSHH $H fdH%(H$1IH\$H|$ H)D$HL?t~1H|$IؾL ;H H x5H|$A1DžxH|$H|$XH$dH+%(u,H [H=eH .H1@AWAVAUATUSHH $HdH%(H$1HH=RHHH541EED$$H|$H$HHD$HT$D$ 0HD$(HD$0D$8D$<1AąFH$H511H5;CH5;1CH5;1CH5;T1CH5 <T1CH5<T1{C H53<T1`S 1H5IS 1H5_<kd/H5y<11H5<fH5<1HLH5=1L-H571UL1HyL9u Hk$E1H=L5=`MDMDLDE1AH+AuHE1L5>MDMDLDE1AHAuD$ HkHL|$@IT$ H5o=1AK|hH~L.L1H5JIIuɿ ID$ D$ uLL5=AMEMDLEE1AI.AuHâE1L-=KD DLDC1AHAu1Ld$@L-L5<H5T=1AJ8HtlL4LL1IIuο HuH$dH+%(H[]A\A]A^A_fL11H5;1HH5*1H=)1Hd]H=A.1H H!8 fAWAVIHAUIATUSH(M&MIA$Lt1@I9vJADH H uHBHuHRAu@8u91DH *AD-8u.uEH([]A\A]A^A_É1f.11Ʌɉ@ ʉ ʉ H 8i1|T:ؿ @t$T$oT$t$HIHhP@CIL(A<$t;af.AL$ADL4HMMdA<$u(ID$H9wtI9wA1fDA:T$vIHIMH([]A\A]A^A_@A}M.H([]A\A]A^A_ L$T$HD$iHcL$LD$HT$IDtHH@LD$H|$ H([]A\A]A^A_ IHt3LpH@YH zH5H= ff.@AWAVAUATUSHHIHHIH SHsHHHHH9Lc8HHHH9KAI,$IHH1@HI<uH!I4E1AwIu?Lc(LL$II!L c0HsHLLHHjSLL$AIHHI9DLc8HH!I4HtDHH!IHjH륐DzHDH vHC8H{?D{HC0I9tR11IHv-L{(HsL$II!L {0LLHH荭L$AHH9wLHpHC Hs(HC0L!H9u+LLHMHCH[]A\A]A^A_fH{uHC(Ls0C@H1H5HS(H%1ɾf.@HHHtKLc8o1H b~H5<H=H C}H5H=kff.AW1AVIAUMnHMATUSHHXH|$8dH%(HD$H1H>HFH5 HHD$(+1H5L1H5 L HIdžIdžIdžHD$ HLMIH|$ IH\$0HD$HDH|$<1fH)4 uH\$H|$(HHaH|$0HHHIHD$HD$@H$HHIL1DH)ڍuANXH4$LHAN\HH!HD$@HHHHLl$L,$CfDANXLLHL$@HQH1H!HHD$@ϨHHNLHuLl$HI+H|$HHFIHt7fDLLL%HHzLHIHuHI8IHtNLt$LIHtHLLHHLH?IHuLt$H|$HeHHAH|$I(Ld$HHt4HLHUHHHLHHuHt$H|$ HD$HJHt$ H|$8{HD$ HHD$HdH+%(uuHX[]A\A]A^A_fDLl$H1t1fH)4 uHL11~1HL1sHHNBFT*identify-ctrlidentify namespace list: %sidentify namespace: %snvme%dn%dnvme-subsys%dtcpfailed to open %s: %s failed to write to %s: %s Discovery log is saved to %s /usr/run/nvmereserved%s DIM %s command success mctp:mctp:%u,%hhu:%umctp:%u,%hhuinvalid device specifier '%s'80094420, ignoring --persistent/etc/nvme/config.json/sys/firmware/acpi/tablestransportSTRtransport typesubsystem nqntransport addresstrsvcidhost-traddrhost traddr (e.g. FC WWN's)host-ifaceuser-defined hostnqnhostiddhchap-secretkeyringtls-key-identityTLS key identitynr-io-queuesnr-write-queuesnr-poll-queuesqueue-sizekeep-alive-tmoreconnect-delayctrl-loss-tmofast_io_fail_tmotostype of servicetls_keyTLS key to use (key id)duplicate-connectdisable-sqflowhdr-digestdata-digestenable TLSconcatenable secure concatenationDEVoutput-formatFMTFILEsave raw output to filequietverboseIncrease logging verbositydump-configforceOnly look at NBFT tablesno-nbftDo not look at NBFT tablesnbft-pathcontextInvalid output formatnoneFailed to scan topology: %s /dev/SSNS %d: no controller found rdmahost_traddr required for fc nvme_ctrl_is_persistent/etc/nvme/discovery.confNo params given and no %s discover = ctrl device %s not found%s Increase output verbositytimeoutFailed to scan nvme subsystemInvalid device name %sFailed to scan topology: %s(optional) desired namespaceraw-binaryhuman-readableshow info in readable formatsmart log: %sgroupsReturn ANA groups only.ANA log length %zu too largeana-log: %soutput-filehost-generatecontroller-initdata-arearaeRetain an Asynchronous Eventget-telemetry-log: %sERROR : %s: : fsync : %sgroup-idendurance log: %sshow log in readable formatshow log in binary formateffects log pagesupported log pages: %slog-entriesnumber of entries to retrievedump in binary formatcould not identify controlleruse binary outputfw log: %schanged ns list log: %snvmset-idNVM Set Identifiernumber of bytes to retrievepersistent event log: %slba status log page: %sresv notifi log: %slsplog specific fieldinvalid lsp param: %uboot partition log: %sData flushed into file %s Target Controller ID.invalid action: %uphy-rx-eom-log: %sdomain-idDomain Identifiermedia unit status log: %smosmanagement operation specificmanagement operationI/O Management Sendget-namespace-idio-mgmt-sendI/O Management Receiveio-mgmt-recvlog-ididentifier of log to retrievelog-lenhow many bytes to retrieveaenlpoIONUMlsiuuid-indexUUID indexoutput in raw formatoffset typexfer-lenread chunk size (default 4k)invalid lsp paraminvalid uuid index paramsanitize status log: %sfid support effects log: %scntidcontroller to displayid controller list: %sI/O command set identifierinvalid nsid parameterid namespace list: %slba-format-indexendgrp-idEndurance Group IDinvalid output formatId endurance group list: %snamespace to deleteget-namespace-id: %s%s: Success, deleted nsid:%d delete namespace: %sattach namespacedetach namespacenamespace to attach%s: Success, nsid:%d nszesize of ns (NSZE)ncapcapacity of ns (NCAP)flbasdpsnmicanagrp-idNVM Set Identifier (NVMSETID)endg-idblock-sizecommand set identifier (CSI)lbstmnphndlsnsze-siSTRINGncap-siazrrarrnumzrwaidentify-namespace: %sidentify failed identify-controller: %sidentify controller failed Invalid Placement handle list%s: Success, created nsid:%d create namespace: %sderegisternqn.2014-08.org.nvmexpress.discoveryfailed to identify controller, error %s Data area 4 unsupported, bit 6 of Log Page Attributes not setInvalid data area parameter - %dERROR: No telemetry data blockInvalid specification of both %s and its SI argument, please specify only oneExpected long suffixed integer argument for '%s-si' but got '%s'!SSNS %d reported as unavailable, skipping Discovery Descriptor %d: failed to get discovery log: %s Discovery Descriptor %d: no controller found Discovery Descriptor %d: connect with host_traddr="%s" failed, success after omitting host_traddr failed to get discovery log: %s already connected to hostnqn=%s,nqn=%s,transport=%s,traddr=%s,trsvcid=%s %s DIM %s command error. Status:0x%04x - %s %s DIM %s command error. Result:0x%04x, Status:0x%04x - %s warning: %s:%d not a direct transport! %s is not a block or character devicetransport service id (e.g. IP port)host interface (for tcp transport)user-defined hostid (if default not used)user-defined dhchap key (if default not used)Keyring for TLS key lookup (key id or keyring name)TLS key to use (key id or key in interchange format)number of io queues to use (default is core count)number of write queues to use (default 0)number of poll queues to use (default 0)number of io queue elements to use (default 128)keep alive timeout period in secondsreconnect timeout period in secondscontroller loss timeout period in secondsfast I/O fail timeout (default off)allow duplicate connections between same transport host and subsystem portdisable controller sq flow control (default false)enable transport protocol header digest (TCP transport)enable transport protocol data digest (TCP transport)use existing discovery controller deviceOutput format: normal|json|binarypersistent discovery connectionsuppress already connected errorsUse specified JSON configuration file or 'none' to disableDump configuration file to stdoutForce persistent discovery controller creationuser-defined path for NBFT tablesexecution context identification stringFailed to create topology root: %s Failed to access ACPI tables directorySSNS %d points to well-known discovery NQN, skipping SSNS %d: connect with host_traddr="%s" failed, success after omitting host_traddr Discovery Descriptor %d: failed to parse URI %s Discovery Descriptor %d: unsupported scheme '%s' Discovery Descriptor %d: unsupported transport '%s' Discovery Descriptor %d: failed to add discovery controller: %s host_iface not permitted for rdma or fc failed to connect to hostnqn=%s,nqn=%s,%s ctrl device %s found, ignoring non matching command-line options ctrl device %s found, ignoring non discovery controller failed to add controller, error %s timeout value, in millisecondsRetrieve information for subsystemsFailed to scan nvme subsystem for %sRetrieve SMART log for the given device (or optionally a namespace) in either decoded format (default) or binary.Retrieve ANA log for the given device in decoded format (default), json or binary.ERROR : nvme_identify_ctrl() failed: %sFile name to save raw binary, includes headerHave the host tell the controller to generate the reportGather report generated by the controller.Pick which telemetry data area to report. Default is 3 to fetch areas 1-3. Valid options are 1, 2, 3, 4.Retrieve telemetry log and write to binary filePlease provide an output file!Failed to open output file %s: %s!Warning: Telemetry Controller-Initiated Data Not Available.Failed to acquire telemetry log %d! ERROR: %s: : write failed with error : %sFailure: Unexpected telemetry log overwrite - data_remaining = 0x%x, data_written = 0x%x The endurance group identifierRetrieves endurance groups log page and prints the log.Retrieve command effects log page and print the table.Retrieve supported logs and print the table.Retrieve specified number of error log entries from a given device in either decoded format (default) or binary.non-zero log-entries is required paramRetrieve the firmware log for the specified device in either decoded format (default) or binary.Retrieve Changed Namespaces log for the given device in either decoded format (default) or binary.Retrieve Predictable latency per nvm set log page and prints it for the given device in either decoded format(default),json or binary.predictable latency per nvm set: %sNumber of pending NVM Set log Entries listRetrieve Predictable Latency Event Aggregate Log page and prints it, for the given device in either decoded format(default), json or binary.predictable latency event aggregate log page: %saction the controller shall take during processing this persistent log page command.Retrieve Persistent Event log info for the given device in either decoded format(default), json or binary.Releasing Persistent Event Log ContextEstablishing Persistent Event Log ContextCollected Persistent Event Log may be invalid, Re-read the log is requiredNumber of pending Endurance Group Event log Entries listRetrieve Retrieve Predictable Latency Event Aggregate page and prints it, for the given device in either decoded format(default), json or binary.endurance group event aggregate log page: %sRetrieve Get LBA Status Info Log and prints it, for the given device in either decoded format(default),json or binary.Retrieve Reservation Notification log page and prints it, for the given device in either decoded format(default), json or binary.boot partition data output file nameRetrieve Boot Partition log page and prints it, for the given device in either decoded format(default), json or binary.Failed to flush all data to file! Retrieve Physical Interface Receiver Eye Opening Measurement log for the given device in decoded format (default), json or binary.invalid measurement quality: %uRetrieve the configuration and wear of media units and print itRetrieve the list of Supported Capacity Configuration Descriptorssupported capacity configuration list logidentifier of desired namespaceoptional file for data (default stdin)buffer len (if) data is sent or receivedio-mgmt-send: Success, mos:%u mo:%u nsid:%d optional file for data (default stdout)io-mgmt-recv: Success, mos:%u mo:%u nsid:%d result of the aen, use to override log idlog page offset specifies the location within a log page from where to start returning datalog specific identifier specifies an identifier that is required for a particular log pageRetrieve desired number of bytes from a given log on a specified device in either hex-dump (default) or binary formatnon-zero or non-dw alignment log-len is required paramxfer-len argument invalid. It needs to be multiple of 4kDevice:%s log-id:%d namespace-id:%#x Retrieve sanitize log and show it.Retrieve FID Support and Effects log and show it.Retrieve NVMe-MI Command Support and Effects log and show it.mi command support effects log: %soptional namespace attached to controllerShow controller list information for the subsystem the given device is part of, or optionally controllers attached to a specific namespace.first nsid returned list should start fromshow all namespaces in the subsystem, whether attached or inactiveFor the specified controller handle, show the namespace list in the associated NVMe subsystem, optionally starting with a given nsid.The index into the LBA Format list identifying the LBA Format capabilities that are to be returnedSend an Identify Namespace command to the given device, returns capability field properties of the specified LBA Format index in various formats.identify namespace for specific LBA formatShow endurance group list information for the given endurance group idDelete the given namespace by sending a namespace management command to the provided device. All controllers should be detached from the namespace prior to namespace deletion. A namespace ID becomes inactive when that namespace is detached or, if the namespace is not already inactive, once deleted.optional comma-sep controller id list%s: namespace-id parameter requiredwarning: empty controller-id list will result in no actual change in namespace attachment %s: controller id list is malformedAttach the given namespace to the given controller or comma-sep list of controllers. ID of the given namespace becomes active upon attachment to a controller. A namespace must be attached to a controller before IO commands may be directed to that namespace.Detach the given namespace from the given controller; de-activates the given namespace's ID. A namespace must be attached to a controller before IO commands may be directed to that namespace.Formatted LBA size (FLBAS), if entering this value ignore 'block-size' fielddata protection settings (DPS)multipath and sharing capabilities (NMIC)ANA Group Identifier (ANAGRPID)Endurance Group Identifier (ENDGID)target block size, specify only if 'FLBAS' value not enteredlogical block storage tag mask (LBSTM)Number of Placement Handles (NPHNDLS)size of ns (NSZE) in standard SI unitscapacity of ns (NCAP) in standard SI unitsAllocate ZRWA Resources (AZR) for Zoned Namespace Command SetRequested Active Resources (RAR) for Zoned Namespace Command SetRequested Open Resources (ROR) for Zoned Namespace Command SetRequested Number of ZRWA Resources (RNUMZRWA) for Zoned Namespace Command SetComma separated list of Placement Handle Associated RUHSend a namespace management command to the specified device to create a namespace with the given parameters. The next available namespace ID is used for the create operation. Note that create-ns does not attach the namespace to a controller, the attach-ns command is needed.Invalid specification of both FLBAS and Block Size, please specify only oneInvalid value for block size (%lu). Block size must be a power of twoFLBAS corresponding to block size %lu not found Please correct block size, or specify FLBAS directly Invalid ZNS argument is given (CSI:%#x)create_nsdelete_nsid_endurance_grp_listid_ns_lba_formatio_mgmt_recvio_mgmt_sendget_effects_logget_telemetry_logopen_dev_direct?)$yje`[VQLGB=83.told\TLD /sys/class/nvme/nvmeX/reset_controller'. Ensure nvmeX is the device you just activated before reset.Success activating firmware action:%d slot:%d, but firmware requires %s reset Success committing firmware action:%d slot:%dMultiple Update Detected (MUD) Value: %u Detected an overlapping firmware/boot partition image update command sequence due to processing a command from an Admin SQ on a controllerDetected an overlapping firmware/boot partition image update command sequence due to processing a command from a Management EndpointSubsystem-reset: NVM Subsystem Reset not supported.Overwrite invert pattern between passes.Allow unrestricted sanitize exit.Sanitize action: 1 = Exit failure mode, 2 = Start block erase,3 = Start overwrite, 4 = Start crypto erase, 5 = Exit media verificationEnter media verification state.SANACT is Exit Media Verification Stateoffset of the requested propertyshow property in readable formatReads and shows the defined NVMe controller property for NVMe over Fabric. Property offset must be one of: CAP=0x0, VS=0x8, CC=0x14, CSTS=0x1c, NSSR=0x20, NSSD=0x64, CRTO=0x68set-property: %#02x (%s), value: %#lx register: %#04x (%s) not fabrics set-register: %#02x (%s), value: %#lx the value of the property to be setWrites and shows the defined NVMe controller property for NVMe over FabricLBA format to apply (required)[0-3]: protection info off/Type 1/Type 2/Type 3[0-1]: protection info location last/first bytes of metadataAutomatically reset the controller after successful formatThe "I know what I'm doing" flag, skip confirmation before sending commandRe-format a specified namespace on the given device. Can erase all data in namespace (user data erase) or delete data encryption key if specified. Can also be used to change LBAF to change the namespaces reported physical block format.Use the force [--force] option to ignore that. Invalid specification of both LBAF and Block Size, please specify only oneInvalid value for block size (%lu), must be a power of twoInvalid namespace ID, specify a namespace to format or use '-n 0xffffffff' to format all namespaces on this controller.LBAF corresponding to given block size %lu not found Please correct block size, or specify LBAF directly invalid secure erase settings:%dYou are about to format %s, namespace %#x%s. WARNING: Format may irrevocably delete this device's data. You have 10 seconds to press Ctrl-C to cancel this operation. Use the force [--force] option to suppress this warning. Success formatting namespace:%x failed to set block size to %dfailed to re-read partition tablenew value of feature (required)optional file for feature data (default stdin)specifies that the controller shall save the attributeModify the saveable or changeable current operating parameters of the controller. Operating parameters are grouped and identified by FeatureIdentifiers. Feature settings can be applied to the entirecontroller and all associated namespaces, or to only a fewnamespace(s) associated with the controller. Default valuesfor each Feature are vendor-specific and may not be modified.Use get-feature to determine which Features are supported bythe controller and are saveable/changeable.failed to read data buffer from input file: %sset-feature:%#0*x (%s), value:%#0*lx, cdw12:%#0*x, save:%#x %s did not find a pci resource, open failed %sFailed to map registers to userspace. Did your kernel enable CONFIG_IO_STRICT_DEVMEM? You can disable this feature with command line argument io_memory=relaxed Also ensure secure boot is disabled. /sys/class/nvme/%s/device/resource0show info in readable format in case of output_format == normalReads and shows the defined NVMe controller registers in binary or human-readable formatoffset of the requested registerthe value of the register to be setAccess 64-bit registers as 2 32-bitWrites and shows the defined NVMe controller registershow register in readable formatReads and shows the defined NVMe controller register. Register offset must be one of: CAP=0x0, VS=0x8, INTMS=0xc, INTMC=0x10, CC=0x14, CSTS=0x1c, NSSR=0x20, AQA=0x24, ASQ=0x28, ACQ=0x30, CMBLOC=0x38, CMBSZ=0x3c, BPINFO=0x40, BPRSEL=0x44, BPMBL=0x48, CMBMSC=0x50, CMBSTS=0x58, CRTO=0x68, PMRCAP=0xe00, PMRCTL=0xe04, PMRSTS=0xe08, PMREBS=0xe0c, PMRSWTP=0xe10, PMRMSCL=0xe14, PMRMSCU=0xe18Predictable Latency Per NVM Set Log for device: %s Predictable Latency Per NVM Set Log for NVM Set ID: %u Predictable Latency Event Aggregate Log for device: %s Number of Entries Available: %lu Endurance Group Event Aggregate Log for device: %s LBA Status Log for device: %s LBA Status Log Page Length: %u Number of LBA Status Log Namespace Elements: %u Estimate of Unrecoverable Logical Blocks: %u LBA Status Generation Counter: %u Namespace Element Identifier: %u Number of LBA Range Descriptors: %u Number of LBA Range Descriptors (NLRD) set to %#x for NS element %d Reservation Notif Log for device: %s Resv Notif Log Page Type : %u (%s) Num of Available Log Pages : %u FID Supports Effects Log for device: %s FID %02x -> Support Effects Log: %08xMI Commands Support Effects Log for device: %s MI CMD %02x -> Support Effects Log: %08xBoot Partition Log for device: %s Physical Interface Receiver Eye Opening Measurement Log for controller ID: %u EOM Data Generation Number: %u [1:1] : %#x Eye Data Field %sPresent [0:0] : %#x Printable Eye Field %sPresent Log Specific Parameter Field Copy: %u Log Specific Identifier Copy: %u Estimated Time for Good Quality: %u Estimated Time for Better Quality: %u Estimated Time for Best Quality: %u Number of Media Unit Status Descriptors: %u Media Unit Status Descriptor: %u Endurance Group Identifier: %u Capacity Adjustment Factor: %u Channel Identifiers Offset: %u [7:7] : %#x FDP Configuration %sValid [4:4] : %#x FDP Volatile Write Cache %sPresent [3:0] : %#x Reclaim Group Identifier Format Number of Reclaim Unit Handles: %u Number of Namespaces Supported: %u Reclaim Unit Nominal Size: %lu Estimated Reclaim Unit Time Limit: %u Reclaim Unit Handle %d Attributes: %#x (%s) Placement Identifier %u; Reclaim Unit Handle Identifier %u Estimated Active Reclaim Unit Time Remaining (EARUTR): %u Reclaim Unit Available Media Writes (RUAMW): %lu Send a user-defined IO command to the specified device via IOCTL passthrough, return results.Send a user-defined Admin command to the specified device via IOCTL passthrough, return results.Send Get Log Page request to Discovery Controller.Discover NVMeoF subsystems and connect to themDisconnect from all connected NVMeoF subsystemsHost Bytes with Metadata Written (HBMW): %s Media Bytes with Metadata Written (MBMW): %s Number of Supported Capacity Configurations: %u Capacity Configuration Descriptor: %u Capacity Configuration Identifier: %u Number of Endurance Group Configuration Descriptors: %u Total Endurance Group Capacity: %s Spare Endurance Group Capacity: %s Number of Channel Media Units: %u Media Unit Descriptor Length: %u Reclaim Unit Not Fully WrittenReclaim Unit Active Time Limit ExceededController Level Reset Modified Reclaim Unit HandlesImplicitly Modified Reclaim Unit Handle Placement Identifier (PID): %#x Namespace Identifier (NSID): %u Number of LBAs Moved (NLBAM): %u Logical Block Address (LBA): %#lx Reclaim Group Identifier: %u Reclaim Unit Handle Identifier %u NVM Subsystem Hardware Error EventSanitize Media Verification EventSMART/Health Log Snapshot EventTelemetry Controller-InitiatedPredictable Latency Per NVM SetPredictable Latency Event AggregateSupported Capacity Configuration ListEndurance Group Event AggregateFeature Identifiers Supported and EffectsNVMe-MI Commands Supported and EffectsInterrupt Vector ConfigurationAutonomous Power State TransitionHost Controlled Thermal ManagementNon-Operational Power State ConfigPredictable Latency Mode ConfigPredictable Latency Mode WindowEndurance Event Group ConfigurationFlexible Direct Placement EventsPIT not reported and PELPID does not applyEvent not associated with any port and PELPID does not applyPCIe Uncorrectable Non fatal ErrorPCIe Uncorrectable Fatal ErrorEndurance Group Critical Warning ConditionMedia and Data Integrity StatusController Ready Timeout ExceededPersistent Event Log for device: %s Action for Persistent Event Log: %u PCI Subsystem Vendor ID (SSVID): %u NVM Subsystem NVMe Qualified Name (SUBNQN): %-.*s Reporting Context Information (RCI): %u Reporting Context Exists (RCE): %s(%u) Reporting Context Port Identifier Type (RCPIT): %u(%s) Reporting Context Port Identifier (RCPID): %#x No log data can be shown with this log len at least 512 bytes is required or can be 0 to read the complete log page after context establishedEvent Header Additional Info: %u Port Identifier Type (PIT): %u(%s) Vendor Specific Information Length: %u Old Firmware Revision: %lu (%s) New Firmware Revision: %lu (%s) Status Code Type for Firmware Commit Command: %u Status Returned for Firmware Commit Command: %u Vendor Assigned Firmware Commit Result Code: %u Time Stamp Change Event Entry:Milliseconds Since Reset: %lu NVM Subsystem Hardware Error Event Code Entry: %u, %s Namespace Management CDW10: %u End-to-end Data Protection Type Settings: %u Namespace Multi-path I/O and Namespace Sharing Capabilities: %u Format NVM Completion Event Entry:Smallest Format Progress Indicator: %u Sanitize Completion Event Entry:Set Feature ID :%#02x (%s), value:%#08x Thermal Excursion Event Entry:Admin Submission Queue Base AddressAdmin Completion Queue Base AddressController Memory Buffer LocationBoot Partition Memory Buffer LocationController Memory Buffer Memory Space ControlController Memory Buffer StatusController Memory Buffer Elasticity Buffer SizeController Memory Buffer Sustained Write ThroughputPersistent Memory Region CapabilitiesPersistent Memory Region ControlPersistent Memory Region StatusPersistent Memory Region Elasticity Buffer SizePersistent Memory Region Sustained Write ThroughputPersistent Memory Region Memory Space Control LowerPersistent Memory Region Memory Space Control UpperOperating System Namespace NameOperating System Namespace Name Qualifier 1Operating System Namespace Name Qualifier 2Operating System Controller NameHost-Determined Failure RecordOperating System Driver FilenameOperating System Name and BuildOperating System Driver Versiontarget directive type to be enabled/disableddirective specification associated with directive typeshow directive in readable formatshow directive in binary formatwrite/send file (default stdin)Set directive parameters of the specified directive type.invalid directive operations for Identify Directivesinvalid directive operations for Streams Directivesfailed to read data buffer from input file %sdir-send: type %#x, operation %#x, spec_val %#x, nsid %#x, result %#x 64-bit LBA of first block to accessnumber of blocks (zeroes based) on device to accessThe Write Uncorrectable command is used to set a range of logical blocks to invalid.NVME Write Uncorrectable SuccessStorage tag larger than storage tag sizeReference tag larger than allowed by PIFSet DEAC bit, requesting controller to deallocate specified logical blocksforce device to commit data before command completesreference tag for end-to-end PIapp tag mask for end-to-end PIThis bit specifies the Storage Tag field shall be checked as part of end-to-end data protection processingThe Write Zeroes command is used to set a range of logical blocks to zero.Comma separated list of the context attributes in each rangeComma separated list of the number of blocks in each rangeComma separated list of the starting block in each rangeAttribute Integral Dataset for WriteAttribute Integral Dataset for ReadAll the command DWORD 11 attributes. Use instead of specifying individual attributesThe Dataset Management command is used by the host to indicate attributes for ranges of logical blocks. This includes attributes for discarding unused blocks, data read and write frequency, access size, and other information that may be used to optimize performance and reliability.Commit data and metadata associated with given namespaces to nonvolatile media. Applies to all commands finished before the flush was submitted. Additional data may also be flushed by the controller, from any namespace, depending on controller and associated namespace status.Obtain a reservation on a given namespace. Only one reservation is allowed at a time on a given namespace, though multiple controllers may register with that namespace. Namespace reservation will abort with status Reservation Conflict if the given namespace is already reserved.NVME Reservation Acquire successreservation registration actionchange persistence through power loss settingRegister, de-register, or replace a controller's reservation on a given namespace. Only one reservation at a time is allowed on any namespace.Releases reservation held on a namespace by the given controller. If rtype != current reservation type, release will fails. If the given controller holds no reservation on the namespace or is not the namespace's current reservation holder, the release command completes with no effect. If the reservation type is not Write Exclusive or Exclusive Access, all registrants on the namespace except the issuing controller are notified.NVME Reservation Release successrequest extended data structureReturns Reservation Status data structure describing any existing reservations on and the status of a given namespace. Namespace Reservation Status depends on the number of controllers registered for that namespace.force device to commit cached data before performing the verify operationThis bit specifies the Storage Tag field shall be checked as part of Verify operationVerify specified logical blocks on the given device.size of buffer (prints to stdout on success)security-protocol-specific (cf. SPC-4)Obtain results of one or more previously submitted security-sends. Results, and association between Security Send and Receive, depend on the security protocol field as they are defined by the security protocol used. A Security Receive must follow a Security Send made with the same security protocol.NVME Security Receive Command SuccessStarting LBA(SLBA) in 64-bit address of the first logical block addressed by this commandMaximum Number of Dwords(MNDW) specifies maximum number of dwords to returnAction Type(ATYPE) specifies the mechanism the controller uses in determining the LBA Status Descriptors to return.Range Length(RL) specifies the length of the range of contiguous LBAs beginning at SLBAInformation about potentially unrecoverable LBAs.action type (--action) has to be givenOperation to be performed by the controllerValue specific to the value of the Operation field.Least significant 32 bits of the capacity in bytes of the Endurance Group or NVM Set to be createdMost significant 32 bits of the capacity in bytes of the Endurance Group or NVM Set to be createdHost software uses the Capacity Management command to configure Endurance Groups and NVM Sets in an NVM subsystem by either selecting one of a set of supported configurations or by specifying the capacity of the Endurance Group or NVM Set to be createdCapacity Management Command is SuccessCreated Element Identifier for Endurance Group is: %u Created Element Identifier for NVM Set is: %u Read directive parameters of the specified directive type.Opcode or Feature Identifier (OFI) specifies the command opcode or Set Features Feature Identifier identified by the Scope field.[0-3] Interface (INF) field identifies the interfaces affected by this command.[0-1]Prohibit(PRHBT) bit specifies whether to prohibit or allow the command opcode or Set Features Feature Identifier specified by this command.[0-15]Scope(SCP) field specifies the contents of the Opcode or Feature Identifier field.UUID Index - If this field is set to a non-zero value, then the value of this field is the index of a UUID in the UUID List that is used by the command.If this field is cleared to 0h, then no UUID index is specifiedThe Lockdown command is used to control the Command and Feature Lockdown capability which configures the prohibition or allowance of execution of the specified command or Set Features command targeting a specific Feature Identifier.invalid UUID index settings:%dLockdown Command is Successful"%s" not supported. Install lib uuid and rebuild.hostnqn is not available -- use nvme gen-hostnqnOptional secret (in hexadecimal characters) to be used to initialize the host key.Length of the resulting key (32, 48, or 64 bytes).Host NQN to use for key transformation.HMAC function to use for key transformation (0 = none, 1 = SHA-256, 2 = SHA-384, 3 = SHA-512).Generate a DH-HMAC-CHAP host key usable for NVMe In-Band Authentication.Invalid key length %d for SHA(256)Invalid key length %d for SHA(384)Invalid key length %d for SHA(512)DH-HMAC-CHAP key (in hexadecimal characters) to be validated.Check a DH-HMAC-CHAP host key for usability for NVMe In-Band Authentication.Invalid key length for SHA(256)Invalid key length for SHA(384)Invalid key length for SHA(512)Base64 decoding failed, error %dBase64 decoding failed (%s, size %u)CRC mismatch (key %08x, crc %08x)Key is valid (HMAC %d, length %d, CRC %08x) Failed to lookup keyring '%s', %sFailed to get identity info, %sFailed to read back derive TLS PSK, %sFailed to append key to '%', %sHost NQN for the retained key.Subsystem NQN for the retained key.Optional secret (in hexadecimal characters) to be used for the TLS key.Update key file with the derive TLS PSK.HMAC function to use for the retained key (1 = SHA-256, 2 = SHA-384).TLS identity version to use (0 = NVMe TCP 1.0c, 1 = NVMe TCP 2.0Insert retained key into the keyring.Generate a TLS key in NVMe PSK Interchange format.Invalid TLS identity version %uFailed to insert key, error %dTLS key (in PSK Interchange format) to be validated.TLS identity version to use (0 = NVMe TCP 1.0c, 1 = NVMe TCP 2.0)Check a TLS key for NVMe PSK Interchange format. Key decoding failed, error %d Need to specify a subsystem NQNFailed to generate identity, error %dImport all keys into the keyring.Export all keys from the keyring.Cannot open keyfile %s, error %dMust specify either --import, --export or --revokeExport of TLS keys failed with '%s'Failed to import key in line %dImport of TLS keys failed with '%s'Transfer security protocol data to a controller. Security Receives for the same protocol should be performed after Security Sends. The security protocol field associates Security Sends (security-send) and Security Receives (security-recv).WARNING: --tl not dword aligned; unaligned bytes may be truncatedFailed to read data from security file %s with %sNVME Security Send Command Success64-bit addr of first block to accesslimit num. media access attemptsThis bit specifies the Storage Tag field shall be checked as part of end-to-end data protection processingdirective type (for write-only)directive specific (for write-only)dataset management attributes (lower 8 bits)show command instead of sendingThe "I know what I'm doing" flag, do not enforce exclusive access for writeRounding data size to fit block count (%lld bytes)Rounding metadata size to fit block count (%lld bytes)failed to read meta-data buffer from input file %swrite: %s: failed to write buffer to output filewrite: %s: failed to write meta-data buffer to output fileCompare specified logical blocks on device with specified data buffer; return failure if buffer and block(s) are dissimilarCopy specified logical blocks on the given device to specified data buffer (default buffer is stdout).Copy from provided data buffer (default buffer is stdin) to specified logical blocks on the given device.failed to read write buffer %s%s Command is Success and result: 0x%08x (status: 0x%02x, response: 0x%06x) Send a NVMe-MI Receive command to the specified device, return results.Send a NVMe-MI Send command to the specified device, return results.64-bit addr of first destination logical block64-bit addr of first block per range (comma-separated list)number of blocks per range (comma-separated list, zeroes-based values)source namespace identifier per range (comma-separated list)source options per range (comma-separated list)protection information and check field (write part)protection information and check field (read part)initial lba reference tag (write part)expected lba reference tags (read part, comma-separated list)lba application tag (write part)expected lba application tags (read part, comma-separated list)lba application tag mask (write part)expected lba application tag masks (read part, comma-separated list)directive specific (write part)The Copy command is used by the host to copy data from one or more source logical block ranges to a single consecutive destination logical block range.formats 2 and 3 require source namespace ids for each source rangeformats 0 and 1 do not support cross-namespace copylibnvme function nvme_init_copy_range_f1 not foundlibnvme function nvme_init_copy_range_f2 not foundlibnvme function nvme_init_copy_range_f3 not foundSubmit a NVMe-MI Send command, return resultsSubmit a NVMe-MI Receive command, return resultsSend Discovery Information Management command to a Discovery ControllerSubmit a Lockdown command,return resultReplay Protection Memory Block commandsManage Flexible Resources between Primary and Secondary ControllerSubmit a Directive Send command, return resultsSubmit a Directive Receive command, return resultsValidate NVMeoF DH-HMAC-CHAP host keyGenerate NVMeoF DH-HMAC-CHAP host keyConfiguration of NVMeoF subsystemsDisconnect from NVMeoF subsystemDiscover and Connect to NVMeoF subsystemsGet a register and show the resulting valueSet a register and show the resulting valueShows the controller registers or properties. Requires character deviceRetrieve sanitize log, show itSubmit a verify command, return resultsSubmit a write uncorrectable command, return resultsSubmit a write zeroes command, return resultsSubmit a write command, return resultsSubmit a read command, return resultsSubmit a Compare command, return resultsSubmit a Flush command, return resultsSubmit a Simple Copy command, return resultsSubmit a Data Set Management command, return resultsSubmit a Reservation Report, return resultsSubmit a Reservation Release, return resultsSubmit a Reservation Register, return resultsSubmit a Reservation Acquire, return resultsSubmit Capacity Management Command, return resultsSubmit a Get LBA Status command, return resultsSubmit a Security Receive command, return resultsSubmit a Security Send command, return resultsSubmit an arbitrary IO command, return resultsSubmit an arbitrary admin command, return resultsVerify and commit firmware to a specific slot (fw-activate in old version < 1.2)Format namespace with new block formatGet a property and show the resulting valueSet a property and show the resulting valueSet a feature and show the resulting valueRetrieve the configuration and wear of media units, show itRetrieve MI Command Support and Effects log and show itRetrieve FID Support and Effects log and show itRetrieve the Supported Log pages details, show itRetrieve the SELF-TEST Log, show itPerform the necessary tests to observe the performanceGet feature and show the resulting valueRetrieve Physical Interface Receiver Eye Opening Measurement, show itRetrieve Boot Partition Log, show itRetrieve Reservation Notification Log, show itRetrieve LBA Status Information Log, show itRetrieve Endurance Group Event Aggregate Log, show itRetrieve Persistent Event Log, show itRetrieve Predictable Latency Event Aggregate Log, show itRetrieve Predictable Latency per Nvmset Log, show itRetrieve Endurance Group Log, show itRetrieve Command Effects Log, show itRetrieve Changed Namespace List, show itRetrieve FW Telemetry log write to fileGeneric NVMe get log, returns log in raw formatRetrieve the namespace ID of opened block deviceDetaches a namespace from requested controller(s)Attaches a namespace to requested controller(s)Deletes a namespace from the controllerCreates a namespace with the provided parametersSend NVMe Identify Endurance Group List, display structureSend NVMe Identify Domain List, display structureSend NVMe Identify I/O Command Set, display structureSend NVMe Identify UUID List, display structureSend NVMe Identify NVM Set List, display structureSend NVMe Namespace Descriptor List, display structureI/O Command Set Independent Identify NamespaceList Secondary Controllers associated with a Primary ControllerSend NVMe Identify Primary Controller CapabilitiesSend NVMe Identify Namespace NVM Command Set for the specified LBA Format index, display structureSend NVMe Identify Namespace NVM Command Set, display structureSend NVMe Identify Controller NVM Command Set, display structureSend NVMe Identify Controller List, display structureSend NVMe Identify List, display structureSend NVMe Identify Namespace for the specified LBA Format index, display structureSend NVMe Identify Namespace Granularity List, display structureSend NVMe Identify Namespace, display structureList all NVMe devices and namespaces on machineThe '' may be either an NVMe character device (ex: /dev/nvme0), an nvme block device (ex: /dev/nvme0n1), or a mctp address in the form mctp:,[:ctrl-id]Event Type: %u DTWIN Reads Typical: %lu DTWIN Writes Typical: %lu DTWIN Time Maximum: %lu NDWIN Time Minimum High: %lu NDWIN Time Minimum Low: %lu DTWIN Reads Estimate: %lu DTWIN Writes Estimate: %lu DTWIN Time Estimate: %lu Entry[%d]: %u Recommended Action Type: %u RSLBA[%d]: %lu RNLB[%d]: %u Empty Log PageRegistration PreemptedReservation ReleasedReservation PreemptedLog Page Count : %lx Namespace ID: : %x FSUPP+ UDCC%s NCC%s NIC%s CCC%s USS%s NAMESPACE SCOPE%s CONTROLLER SCOPE%s NVM SET SCOPE%s ENDURANCE GROUP SCOPE%s DOMAIN SCOPE%s NVM Subsystem SCOPE%s CSUPP+Log ID: %u Boot Partition Size: %u KiB Active BPID: %u Not StartedIn ProgressCompletedNot Not SuccessfulEOM In Progress: %s Header Size: %u Result Size: %u Log Revision: %u Optional Data Present: %u [7:2] : %#x Reserved Lanes: %u Eyes Per Lane: %u Link Information: %u Descriptor Size: %u Number of Descriptors: %u Maximum Top Bottom: %u Maximum Left Right: %u Measurement Status: %s Eye: %u Top: %u Left: %u Number of Rows: %u Number of Columns: %u Eye Data Length: %u Number of Channels: %u Selected Configuration: %u Media Unit Identifier: %u Domain Identifier: %u NVM Set Identifier: %u Available Spare: %u Percentage Used: %u Initially IsolatedPersistently IsolatedFDP Attributes: %#x [6:5] : %#x Reserved Vendor Specific Size: %u Number of Reclaim Groups: %u Reclaim Unit Handle List: [%d]: %s UnusedHost SpecifiedController SpecifiedNVMe%01d%c%02d %*spciefailed to disconnect %s Media Bytes Erased (MBE): %s Endurance Estimate: %s Number of NVM Sets: %u NVM Set %d Identifier: %u Channel Identifier: %u Invalid Placement IdentifierMedia ReallocatedEvent[%u] Event Type: %#x (%s) %c %Z Event Timestamp: %lu (%s) FlushCreate I/O Submission QueueDelete I/O Completion QueueCreate I/O Completion QueueIdentifyAbortSet FeaturesGet FeaturesAsynchronous Event RequestNamespace ManagementFirmware CommitFirmware Image DownloadDevice Self-testNamespace AttachmentKeep AliveDirective SendDirective ReceiveVirtualization ManagementNVMe-MI SendNVMe-MI ReceiveDoorbell Buffer ConfigFormat NVMSecurity SendSecurity ReceiveSanitizeGet LBA StatusZone AppendDelete I/O Submission QueueWrite UncorrectableCompareWrite ZeroesDataset ManagementReservation RegisterReservation ReportReservation AcquireReservation ReleaseCancelVerifyCopyZone Management SendZone Management ReceiveReserved EventFirmware Commit EventTimestamp Change EventPower-on or Reset EventChange Namespace EventFormat NVM Start EventFormat NVM Completion EventSanitize Start EventSanitize Completion EventSet Feature EventSet Telemetry CRT EventThermal Excursion EventVendor Specific EventTCG Defined Event%s(%#x)Supported Log PagesError InformationSMART / Health InformationFirmware Slot InformationChanged Namespace ListTelemetry Host-InitiatedEndurance Group InformationMedia Unit StatusAsymmetric Namespace AccessPersistent Event LogLBA Status InformationCommand and Feature LockdownBoot PartitionFDP ConfigurationsReclaim Unit Handle UsageFDP StatisticsFDP EventsDiscoveryReservation NotificationSanitize StatusChanged Zone ListAQFahrenheitCelsius%ld %s%ld °%sArbitrationPower ManagementLBA Range TypeVolatile Write CacheNumber of QueuesInterrupt CoalescingWrite Atomicity NormalAsync Event ConfigurationHost Memory BufferTimestampKeep Alive TimerRead Recovery LevelLBA Status IntervalHost BehaviorI/O Command Set ProfileSpinup ControlEnhanced Controller MetadataNamespace MetadataSoftware ProgressHost IdentifierReservation Notification MaskReservation PersistenceNamespace Write ProtectFlexible Direct PlacementtruefalseDoes not already existNVM subsystem portNVMe-MI portPCIe Correctable ErrorPCIe Link Status ChangePCIe Link Not ActiveCritical Warning ConditionUnsafe ShutdownController Fatal StatusLog Identifier: %u Total Number of Events: %u Total Log Length : %lu Log Header Length: %u Power On Hours (POH): %sPower Cycle Count: %lu PCI Vendor ID (VID): %u Serial Number (SN): %-.*s Model Number (MN): %-.*s Generation Number: %u [31:19] : %#x Reserved Supported Events Bitmap: Support %s Persistent Event Entries:Event Number: %u Event Type: %s Event Type Revision: %u Event Header Length: %u Controller Identifier: %u Event Timestamp: %lu Port Identifier: %u Event Length: %u Smart Health Event Entry:FW Commit Event Entry:FW Commit Action: %u FW Slot: %u Previous Timestamp: %lu Power On Reset Event Entry:Firmware Revision: %lu (%s) Reset Information List:Controller ID: %u Firmware Activation: %u Operation in Progress: %u Controller Power Cycle: %u Power on milliseconds: %lu Controller Timestamp: %lu Change Namespace Event Entry:Namespace Size: %lu Namespace Capacity: %lu Formatted LBA Size: %u ANA Group Identifier: %u Namespace ID: %u Format NVM Start Event Entry:Namespace Identifier: %u Format NVM Attributes: %u Format NVM CDW10: %u Format NVM Status: %u Completion Information: %u Status Field: %u Sanitize Start Event Entry:SANICAP: %u Sanitize CDW10: %u Sanitize CDW11: %u Sanitize Progress: %u Sanitize Status: %u Set Feature Event Entry: %-53s: %sEnabled Over Temperature: %u Threshold: %u Reserved Event Controller CapabilitiesInterrupt Vector Mask SetInterrupt Vector Mask ClearController ConfigurationController StatusNVM Subsystem ResetAdmin Queue AttributesController Memory Buffer SizeBoot Partition InformationBoot Partition Read SelectNVM Subsystem ShutdownController Ready TimeoutsTemperature Sensor 1Temperature Sensor 2Temperature Sensor 3Temperature Sensor 4Temperature Sensor 5Temperature Sensor 6Temperature Sensor 7Temperature Sensor 8Unknown FeatureOperating System Driver NamePre-boot Namespace NameUnknown Namespace TypeUnknown Controller TypeDisplay Driver VersionDisplay Driver NameFirmware VersionSystem Product NameChipset Driver VersionChipset Driver NameSystem Processor ModelPre-boot Driver VersionPre-boot Driver NamePre-boot Controller Namedir-typetarget-dirdir-specdir-operdirective operationendirdirective enableinput-filetarget-dir required param invalid directive typedir-send: %sstart-blockblock-countInvalid directive type, %xwrite uncorrectable: %sInvalid PIFdeaclimited-retrylimit media access attemptsforce-unit-accessprinfoPI and check fieldref-tagapp-tag-maskapp-tagapp tag for end-to-end PIstorage-tagstorage tag for end-to-end PIstorage-tag-checkwrite-zeroes: %sNVME Write Zeroes Successctx-attrsslbsAttribute DeallocateidwidrNo range definition provideddata-set management: %sNVMe DSM: successflush: %sNVMe Flush: successcrkeycurrent reservation keyprkeypre-empt reservation keyreservation typeracqareservation acquire actioniekeyignore existing res. keyinvalid racqa:%dreservation acquire: %snrkeynew reservation keyrregacptplinvalid cptpl:%dinvalid rrega:%dreservation register: %sNVME Reservation successrrelareservation release actioninvalid rrela:%dreservation release: %snumdnumber of dwords to transferedsdump output in binary formatreservation report: %sverify: %sNVME Verify SuccessnssfNVMe Security Specific Fieldsecpsecurity protocol (cf. SPC-4)spspallocation length (cf. SPC-4)security receive: %sstart-lbamax-dwrange-lenget lba status: %selement-idcap-lowercap-upperinvalid operation field: %ucapacity management: %sreq-resourcenamespace stream requesteddir-receive: %sofiifcprhbtscpinvalid interface settings:%dinvalid prohibit settings:%dinvalid scope settings:%dlockdown: %skey-lengthhmacInvalid HMAC identifier %uInvalid key length %uInvalid secret '%s'Invalid key length (%d bytes)Could not read host NQNDHHC-1:%02x:%s: Key not specifiedDHHC-1:%02x:*sInvalid key header '%s'Invalid HMAC identifier %dInvalid key length %dFailed to parse identity Failed to export key, %sFailed to open '%s', %s.nvmepskKeyring for the retained key.keytypeKey type of the retained key.subsysnqnkeyfileinsertNo subsystem NQN specifiedFailed to read host NQNSkipping excess secret bytes Inserted TLS key %08x keydataNo key dataFile for list of keys.importexportrevokeRevoke key from the keyring.Manipulation of TLS keys. exporting to %s Invalid keyring '%s'Parse error in line %dimporting from %s Failed to revoke key '%s'revoking keyrankingRanking order: namespace|ctrlShow the topology Invalid ranking argument: %stransfer payloadtransfer length (cf. SPC-4)--tl unspecified or zeroFailed to open %s: %ssecurity-send: %ssize of data in bytesmetadata-sizesize of metadata in bytesmetadata filedsmshow-commandshow command before sendingdry-runoutput latency statisticsdata size not providedopcode : %02x nsid : %02x flags : %02x control : %04x nblocks : %04x metadata : %lx addr : %lx slba : %lx dsmgmt : %08x reftag : %lx apptag : %04x appmask : %04x storagetagcheck : %04x storagetag : %lx pif : %02x sts : %02x latency: %s: %llu us submit-io: %s%s: Success compareopcodeopcode (required)data I/O length (bytes)nmimtnvme-mi message typenmd0nvme management dword 0 valuenmd1nvme management dword 1 valuenmi_recv: %sstatus: %s failed to write data buffer%s - NQN=%s %*s hostnqn=%s %*s iopolicy=%s %*s type=%s sdlbasnsidssoptslimited retryforce unit accessprinfowprinforexpected-ref-tagsexpected-app-tagsexpected-app-tag-masksdirective type (write part)source range entry formatinvalid formatinvalid rangenvme_init_copy_range_f1nvme_init_copy_range_f2nvme_init_copy_range_f3NVMe Copy: %sNVMe Copy: successnvme-mi-sendnvme-mi-recvshow-topologyShow the topologydimrpmbvirt-mgmtdir-senddir-receiveManipulate NVMeoF TLS PSKcheck-tls-keyValidate NVMeoF TLS PSKgen-tls-keyGenerate NVMeoF TLS PSKcheck-dhchap-keygen-dhchap-keyshow-hostnqnShow NVMeoF host NQNgen-hostnqnGenerate NVMeoF host NQNdisconnect-alldisconnectConnect to NVMeoF subsystemDiscover NVMeoF subsystemsget-regset-regshow-regsns-rescanRescans the NVME namespacessubsystem-resetResets the subsystemResets the controllersanitize-logsanitizeSubmit a sanitize commandverifywrite-uncorwrite-zeroesflushcopyresv-reportresv-releaseresv-registerresv-acquirecapacity-mgmtget-lba-statussecurity-recvsecurity-sendio-passthruadmin-passthrufw-downloadDownload new firmwarefw-commitfw-activateget-propertyset-propertysupported-cap-config-logmedia-unit-stat-logmi-cmd-support-effects-logfid-support-effects-logsupported-log-pagesself-test-logdevice-self-testphy-rx-eom-logboot-part-logresv-notif-loglba-status-logendurance-event-agg-logpersistent-event-logpred-lat-event-agg-logpredictable-lat-logendurance-logRetrieve Error Log, show itana-logRetrieve ANA Log, show itsmart-logRetrieve SMART Log, show itchanged-ns-list-logfw-logRetrieve FW Log, show itget-ns-iddetach-nsattach-nsdelete-nscreate-nslist-endgrpid-domainid-iocsid-uuidid-nvmsetns-descscmdset-ind-id-nslist-secondaryprimary-ctrl-capsnvm-id-ns-lba-formatnvm-id-nsnvm-id-ctrllist-ctrllist-nsid-ns-granularitySend NVMe Identify Controllerlist-subsysList nvme subsystemsASBSBZCYFMGUKNKYMHMSPRTCVGVI [] []] %-5=EMUi !)19AIQYa ,<L\l|xph`XPH@80( xph`XPH@80(  :-IG5#,p8888888x888888888h8888888`888X888P888H8888888@888888888880888(888 88888888888888888888888888888 ,H@hxX, D  $ dtT2.110w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/lockdown_cmddir_receivecapacity_mgmtget_lba_statusverify_cmdsubmit_ioresv_reportresv_releaseresv_registerresv_acquireflush_cmdcopy_cmddsmwrite_zeroeswrite_uncordir_send [31:24]: %#x Access Size [23:16]: %#x Total Size [15:6] : %#x Reserved [7:1] : %#x Reserved 1.3 or later1.2.1 or earlierdoes not Never nsfeat : %#x [7:6] : %#x Reserved [2:0] : %#x Reserved nmic : %#x rescap : %#x fpi : %#x anagrpid: %u nsattr : %u nvmsetid: %d endgid : %d nstat : %#x %01u.%04uW%01u.%02uWNVMe Identify Controller NVM:vsl : %u wzsl : %u wusl : %u dmrl : %u dmrsl : %u dmsl : %lu aocs : %u [15:1] : %#x Reserved Bit Granularity MaskingByte Granularity MaskingMasking Not Supported16b Guard32b Guard64b GuardQualified Typelbstm : %#lx pic : %#x [7:4] : %#x Reserved pifa : %#x [7:3] : %#x Reserved npdgl : %#x nprg : %#x npra : %#x nors : %#x npdal : %#x lbapss: %#x tlbaag: %#x NVMe ZNS Identify Controller:zasl : %u [%4u]:%#x nr_zones: %lu num of ctrls present: %u cntlid : %#x portid : %#x crt : %#x vqfrt : %u vqrfa : %u vqrfap : %d vqprt : %d vqfrsm : %d vqgran : %d vifrt : %u virfa : %u virfap : %d viprt : %d vifrsm : %d vigran : %d SCEntry[%-3d]: Entry[%2d] : NVME Reservation status: gen : %u rtype : %d regctl : %d ptpls : %d regctl[%d] : cntlid : %x rcsts : %x hostid : %lx rkey : %lx regctlext[%d] : cntlid : %x rcsts : %x rkey : %lx hostid : Firmware Log for device:%s afi : %#x frs%d : %#016lx (%s) no ns changedmore than %d ns changed non-optimizedinaccessiblepersistent-losschangeinvalid stateANA LOG HEADER :-chgcnt : %lu ngrps : %u ANA Log Desc :-grpid : %u nnsids : %u state : %s nsid : %u Sanitize in Progress. (No time period reported) (%f%%) [2:0] %s [7:3] %s: %u [8] %s: %u%s FilesystemRAIDPage / Swap fileVendor SpecificLBA range may be overwritten type : %#x - %s attributes : %#x - %s, %s slba : %#lx nlb : %#lx guid : Not ReportedController scopeDomain scopeNVM subsystem scopeYesI/O Command Set is SupportedNot supportedNVM Command SetAdmin Command Set onlySubsystemTrueFalse64 KB1 MB16 MB256 MB64 GBNOT SHALLMAYOne KBOne MBOne GBminutes500 millisecondsREADYNormal OperationRestore ErrorUnreliableNot ReadyNo notification; no effectNormal shutdown notificationAbrupt shutdown notificationRound RobinShutdown processing occurringShutdown processing completePMR time unit is %s Enable (EN): PMR is %s %s: %#lx %s: %#04x (%s), value: %#lx %-8s: RDMA Transport errorFibre Channel Transport errorTCP Transport errorIntra-host Transport error Entry[%2d] error_count : %lu sqid : %d cmdid : %#x status_field : %#x (%s) phase_tag : %#x parm_err_loc : %#x lba : %#lx nsid : %#x vs : %d trtype : %#x (%s) csi : %d opcode : %#x cs : %#lx trtype_spec_info: %#x log_page_version: %d Current operation : %#x Current Completion : %u%% Self Test Result[%d]: Vendor specificError: %s NVMe status: %s(%#x) NVMe-MI status: %s(%#x) Yes (Host support required) (in use) [15:2] : %#x Reserved zoc : %u ozcs : %u mar : %#x mor : %#x mor : %u Open Resources rrl %s : Not Reported %s : %u frl rrl1rrl2rrl3frl1frl2frl3numzrwa : %#x zrwafg : %u zrwasz : %u zrwacap : %u vs[] :SEQWRITE_REQEMPTYIMP_OPENEDEXP_OPENEDCLOSEDREADONLYFULLOFFLINEUnknown StateExtension Data: Directive support Directive enabled Open Stream Count : %u Stream Identifier %.6u : %u invalid directive type NPDGL, NPDG, NAWUN, NAWUPF, and NACWUAWUN, AWUPF, and ACWUat End of Data LBAin Separate Contiguous BufferFirstLastType 3 EnabledReserved EnabledType 2 EnabledType 1 EnabledCRC of The Value Read0xFFFF0xFF0x00Reserved ValueDegradedGoodBetterBestNVME Identify Namespace %d: nsze : %#lx ncap : %#lx nuse : %#lx nlbaf : %d flbas : %#x mc : %#x [7:7] : %#x Reserved dpc : %#x [7:5] : %#x Reserved nulbaf : %u dlfeat : %d nawun : %d nawupf : %d nacwu : %d nabsn : %d nabo : %d nabspf : %d noiob : %d nvmcap : %s npwg : %u npwa : %u npdg : %u npda : %u nows : %u mssrl : %u mcl : %u msrc : %u nguid : eui64 : vs[]:dps : %#x nid : %d nvmset_id : %d endurance_group_id : %d random_4k_read_typical : %u optimal_write_size : %u total_nvmset_cap : %s unalloc_nvmset_cap : %s Number of Domain Entries: %u critical_warning : %u endurance_group_features: %u avl_spare : %u avl_spare_threshold : %u percent_used : %u%% domain_identifier : %u endurance_estimate : %s data_units_read : %s data_units_written : %s media_units_written : %s host_read_cmds : %s host_write_cmds : %s media_data_integrity_err: %s num_err_info_log_entries: %s total_end_grp_cap : %s unalloc_end_grp_cap : %s loc : %d nidt : %d nidl : %d uuid : %s csi : %#x type : eui64type : nguidtype : csitype : uuidSR-IOVPCIMultiSingle-Only/WriteAllStaticDynamicNotNVME Identify Controller:vid : %#x ssvid : %#x sn : %-.*s mn : %-.*s fr : %-.*s rab : %d ieee : %02x%02x%02x cmic : %#x [2:2] : %#x %s [1:1] : %#x %s Controller [0:0] : %#x %s Port mdts : %d ver : %#x rtd3r : %#x rtd3e : %#x oaes : %#x [30:28] : %#x Reserved [26:17] : %#x Reserved [10:10] : %#x Reserved [7:0] : %#x Reserved ctratt : %#x [31:20] : %#x Reserved [18:18] : %#x Reserved rrls : %#x cntrltype : %d [1:0] : %#x %s fguid : %s crdt1 : %u crdt2 : %u crdt3 : %u nvmsr : %u vwci : %u mec : %u oacs : %#x [15:11] : %#x Reserved acl : %d aerl : %d frmw : %#x lpa : %#x elpe : %d npss : %d avscc : %#x apsta : %#x wctemp : %d cctemp : %d mtfa : %d hmpre : %u hmmin : %u tnvmcap : %s [127:0] : %s unvmcap : %s rpmbs : %#x edstt : %d dsto : %d fwug : %d kas : %d hctma : %#x mntmt : %d mxtmt : %d sanicap : %#x [31:30] : %#x %s [28:4] : %#x Reserved hmminds : %u hmmaxd : %d nsetidmax : %d endgidmax : %d anatt : %d anacap : %d [5:5] : %#x Reserved anagrpmax : %u nanagrpid : %u pels : %u domainid : %d megcap : %s tmpthha : %#x sqes : %#x cqes : %#x maxcmd : %d nn : %u oncs : %#x fuses : %#x fna : %#x vwc : %#x [2:1] : %#x %s awun : %d awupf : %d icsvscc : %d nwpc : %d acwu : %d ocfs : %#x [15:4] : %#x Reserved sgls : %#x [31:22]: %#x Reserved [1:0] : %#x Reserved mnan : %u maxdna : %s maxcna : %u oaqd : %u subnqn : %-.*s ioccsz : %u iorcsz : %u icdoff : %d fcatt : %#x msdbd : %d ofcs : %d ps %4d : mp:%01u.%04uW %01u.%02uW non- active_power:1MiB 32 RW, 30s idle80K 128KiB SWNVMe Changed Zone List:nrzid: %u zid %03d: %lu Feature is saveable Feature is per-namespace Feature is changeableNo association reportedassociated with PCI Vendor IDNVME Identify UUID: Entry[%3d] association : %#x %s UUID : %s (Invalid UUID) .................ACS%-6d[%-32s] %08xIOCS%-5d[%-32s] %08x LBCC%s No CSER defined Reserved CSER No command restriction Reserved CSE Failed to open streamNVM Command Set Log Page%-.80s KV Command Set Log PageZNS Command Set Log PageUnknown Command Set Log PageVendor Specific I/O CommandsLID %#x - %s LSUPP is %s IOS is %s critical_warning : %#x temperature : %s (%u K) available_spare : %u%% percentage_used : %u%% Data Units Read : %s (%s) host_read_commands : %s host_write_commands : %s controller_busy_time : %s power_cycles : %s power_on_hours : %s unsafe_shutdowns : %s media_errors : %s num_err_log_entries : %s ../nvme-print-stdout.cwidth < sizeof(ascii)%3x %04x: %02x %*s "%.*s" Element[%-3d]: Type : %#02x (%s) Revision : %d Length : %d Value : %s CurrentDefaultSavedSupported capabilitiesNo WorkloadHeavy Sequential WritesOver Temperature ThresholdUnder Temperature ThresholdSend async eventDo not send async eventDeterministic Window (DTWIN)No Write ProtectPermanent Write ProtectNo limit Workload Hint (WH): %u - %s Power State (PS): %u Coalescing Disable (CD): %s Interrupt Vector (IV): %u Disable Normal (DN): %s Auto PST Entries ................. Entry[%2d] Enable Event :%04x DTWIN Reads Threshold :%lu DTWIN Writes Threshold:%lu DTWIN Time Threshold :%lu Window Select: %s I/O Command Set Profile: %s Namespace Write Protect: %s %6.2f %2sB / %6.2f %2sB%3.0f %2sB + %2d B/dev/spdk//dev/ng%dn%dPiTiGiMiKiOfflineOnlineController type not reportedI/O ControllerDiscovery ControllerAdministrative ControllerNot Enforced [5:3] : %#x Authentication Method [2:0] : %#x Number of RPMB Units [0:0] : %#x Namespace Multipath %sCapable [7:7] : %#x Ignore Existing Key - Used as defined in revision %s [6:6] : %#x Exclusive Access - All Registrants %sSupported [5:5] : %#x Write Exclusive - All Registrants %sSupported [4:4] : %#x Exclusive Access - Registrants Only %sSupported [3:3] : %#x Write Exclusive - Registrants Only %sSupported [2:2] : %#x Exclusive Access %sSupported [1:1] : %#x Write Exclusive %sSupported [0:0] : %#x Persist Through Power Loss %sSupported [6:0] : %#x Format Progress Indicator (Remaining %d%%) [7:7] : %#x Format Progress Indicator %sSupported NVME Identify Command Set Independent Namespace %d: [5:5] : %#x Volatile Write Cache is %sPresent [4:4] : %#x Namespace %sstore data on rotational media [3:3] : %#x NGUID and EUI64 fields if non-zero, %sReused [0:0] : %#x Namespace %sWrite Protected [0:0] : %#x Name space is %sready [0:0] : %#x Reporting Allocated LBA %sSupported NVMe NVM Identify Namespace %d: NVMe NVM Identify Namespace for LBA format[%d]: [3:3] : %#x Qualified Protection Information Format %sSupported [2:2] : %#x Storage Tag Check Read %sSupported [1:1] : %#x 16b Guard Protection Information Storage Tag Mask [0:0] : %#x 16b Guard Protection Information Storage Tag %sSupported [2:0] : %#x Storage Tag Masking Level Attribute : %s Extended LBA Format %2d : Qualified Protection Information Format: %s(%d) - Protection Information Format: %s(%d) - Storage Tag Size (MSB): %-2d %s elbaf %2d : qpif:%d pif:%d sts:%-2d %s NVME Identify Primary Controller Capabilities: [1:1] %#x VI Resources are %ssupported [0:0] %#x VQ Resources are %ssupported Identify Secondary Controller List: NUMID : Number of Identifiers : %d SCID : Secondary Controller Identifier : %#.04x PCID : Primary Controller Identifier : %#.04x SCS : Secondary Controller State : %#.04x (%s) VFN : Virtual Function Number : %#.04x NVQ : Num VQ Flex Resources Assigned : %#.04x NVI : Num VI Flex Resources Assigned : %#.04x Identify Namespace Granularity List: ATTR : Namespace Granularity Attributes: %#x NUMD : Number of Descriptors : %d NSG : Namespace Size Granularity : %#lx NCG : Namespace Capacity Granularity : %#lx num of endurance group ids: %u I/O Command Set Combination[%u]:%lx Asymmetric Namespace Access Log for NVMe device: %s NVM Subsystem has never been sanitized.Most Recent Sanitize Command Completed Successfully.Most Recent Sanitize Command Failed.Most Recent Sanitize Command (No-Deallocate After Sanitize) Completed Successfully.Global Data Erased set: no NS LB in the NVM subsystem has been written to and no PMR in the NVM subsystem has been enabledGlobal Data Erased cleared: a NS LB in the NVM subsystem has been written to or a PMR in the NVM subsystem has been enabledSanitize Progress (SPROG) : %uSanitize Status (SSTAT) : %#x Number of completed passes if most recent operation was overwriteSanitize Command Dword 10 Information (SCDW10) : %#x Estimated Time For Overwrite Estimated Time For Block Erase Estimated Time For Crypto Erase Estimated Time For Overwrite (No-Deallocate) Estimated Time For Block Erase (No-Deallocate) Estimated Time For Crypto Erase (No-Deallocate)LBA range should be hidden from the OS/EFI/BIOSLBA range should be visible from the OS/EFI/BIOSLBA range should not be overwritten LBA Status Information Poll Interval (LSIPI) : %u LBA Status Information Report Interval (LSIRI): %u Number of LBA Status Descriptors(NLSD): %u Completion Condition(CMPC): %u No indication of the completion condition Completed transferring the amount of data specified in the MNDW field. But, additional LBA Status Descriptor Entries are available to transfer or scan did not complete (if ATYPE = 10h) Completed the specified action over the number of LBAs specified in the Range Length field and transferred all available LBA Status Descriptor Entries{ DSLBA: %#016lx, NLB: %#08x, Status: %#02x } Only Admin Command Set SupportedAll supported I/O Command Sets NVM Subsystem Shutdown Enhancements Supported (NSSES): %s Controller Ready With Media Support (CRWMS): %s Controller Ready Independent of Media Support (CRIMS): %s NVM Subsystem Shutdown Supported (NSSS): %s Controller Memory Buffer Supported (CMBS): The Controller Memory Buffer is %s Persistent Memory Region Supported (PMRS): The Persistent Memory Region is %s Memory Page Size Maximum (MPSMAX): %u bytes Memory Page Size Minimum (MPSMIN): %u bytes Controller Power Scope (CPS): %s Boot Partition Support (BPS): %s Command Sets Supported (CSS): NVM command set is %s One or more I/O Command Sets are %s %s NVM Subsystem Reset Supported (NSSRS): %s Doorbell Stride (DSTRD): %u bytes Timeout (TO): %u ms Arbitration Mechanism Supported (AMS): Weighted Round Robin with Urgent Priority Class is %s Contiguous Queues Required (CQR): %s Maximum Queue Entries Supported (MQES): %u NVMe specification %d.%d.%d Interrupt Vector Mask Set (IVMS): %#lx Interrupt Vector Mask Clear (IVMC): %#lx Controller Ready Independent of Media Enable (CRIME): %s I/O Completion Queue Entry Size (IOCQES): %u bytes I/O Submission Queue Entry Size (IOSQES): %u bytes Shutdown Notification (SHN): Arbitration Mechanism Selected (AMS): Weighted Round Robin with Urgent Priority Class Memory Page Size (MPS): %u bytes I/O Command Set Selected (CSS): %s Enable (EN): %s Shutdown Type (ST): %s Processing Paused (PP): %s NVM Subsystem Reset Occurred (NSSRO): %s Shutdown Status (SHST): Normal operation (no shutdown has been requested) Controller Fatal Status (CFS): %s Ready (RDY): %s NVM Subsystem Reset Control (NSSRC): %lu Admin Completion Queue Size (ACQS): %u Admin Submission Queue Size (ASQS): %u Admin Submission Queue Base (ASQB): %lx Admin Completion Queue Base (ACQB): %lx Controller Memory Buffer feature is not supported Offset (OFST): %#x (See cmbsz.szu for granularity) CMB Queue Dword Alignment (CQDA): %d CMB Data Metadata Mixed Memory Support (CDMMMS): %s CMB Data Pointer and Command Independent Locations Support (CDPCILS): %s CMB Data Pointer Mixed Locations Support (CDPMLS): %s CMB Queue Physically Discontiguous Support (CQPDS): %s CMB Queue Mixed Memory Support (CQMMS): %s Base Indicator Register (BIR): %#x Size (SZ): %u Size Units (SZU): %s Write Data Support (WDS): Write Data and metadata transfer in Controller Memory Buffer is %s Read Data Support (RDS): Read Data and metadata transfer in Controller Memory Buffer is %s PRP SGL List Support (LISTS): PRP/SG Lists in Controller Memory Buffer is %s Completion Queue Support (CQS): Admin and I/O Completion Queues in Controller Memory Buffer is %s Submission Queue Support (SQS): Admin and I/O Submission Queues in Controller Memory Buffer is %s Active Boot Partition ID (ABPID): %u Boot Read Status (BRS): No Boot Partition read operation requestedBoot Partition read in progressBoot Partition read completed successfullyError completing Boot Partition read Boot Partition Size (BPSZ): %u Boot Partition Identifier (BPID): %u Boot Partition Read Offset (BPROF): %x Boot Partition Read Size (BPRSZ): %x Boot Partition Memory Buffer Base Address (BMBBA): %lx Controller Base Address (CBA): %lx Controller Memory Space Enable (CMSE): %lx Capabilities Registers Enabled (CRE): CMBLOC and CMBSZ registers are %senabled Controller Base Address Invalid (CBAI): %x CMB Elasticity Buffer Size Base (CMBWBZ): %#x Read Bypass Behavior : memory reads not conflicting with memory writes in the CMB Elasticity Buffer %s bypass those memory writes CMB Elasticity Buffer Size Units (CMBSZU): %s CMB Sustained Write Throughput (CMBSWTV): %#x CMB Sustained Write Throughput Units (CMBSWTU): %s/second NVM Subsystem Shutdown Control (NSSC): %#x CRIMT : %d secs CRWMT : %d secs Controller Memory Space Supported (CMSS): Referencing PMR with host supplied addresses is %sSupported Persistent Memory Region Timeout (PMRTO): %x Persistent Memory Region Write Barrier Mechanisms (PMRWBM): %x Persistent Memory Region Time Units (PMRTU): Base Indicator Register (BIR): %x Write Data Support (WDS): Write data to the PMR is %ssupported Read Data Support (RDS): Read data from the PMR is %ssupported Controller Base Address Invalid (CBAI): %x Health Status (HSTS): %s Not Ready (NRDY): The Persistent Memory Region is %s to process PCI Express memory read and write requests Error (ERR): %x PMR Elasticity Buffer Size Base (PMRWBZ): %x memory reads not conflicting with memory writes in the PMR Elasticity Buffer %s bypass those memory writes PMR Elasticity Buffer Size Units (PMRSZU): %s PMR Sustained Write Throughput (PMRSWTV): %x PMR Sustained Write Throughput Units (PMRSWTU): %s/second Controller Base Address (CBA): %#x Controller Memory Space Enable (CMSE): %#x unknown register: %#04x (%s), value: %#lx The transport type is not indicated or the error is not transport relatedError Log Entries for device:%s entries:%d Entry not used (does not contain a result)Device Self Test Log for NVME device:%s Operation Result : %#x Self Test Code : %x Short device self-test operation Extended device self-test operation Segment Number : %#x Valid Diagnostic Information : %#x Power on hours (POH) : %#lx Namespace Identifier : %#x Failing LBA : %#lx Status Code Type : %#x Status Code : %#x Vendor Specific : %#x %#x Unknown status type %d, value %#x ZNS Command Set Identify Namespace:zoc : %u Zone Operation Characteristics [1:1] : %#x Zone Active Excursions: %s [0:0] : %#x Variable Zone Capacity: %s ozcs : %u Optional Zoned Command Support [0:0] : %#x Read Across Zone Boundaries: %s [1:1] : %#x Zone Random Write Area: %s mar : No Active Resource Limitmar : %u Active Resources mor : No Open Resource Limitzrwacap : %u Zone Random Write Area Capability [0:0] : %#x Explicit ZRWA Flush Operations: %s LBA Format Extension %2d : Zone Size: %#lx LBAs - Zone Descriptor Extension Size: %-1d bytes%s lbafe %2d: zsze:%#lx zdes:%u%s SLBA: %#-10lx WP: %#-10lx Cap: %#-10lx State: %-12s Type: %-14s Attrs: Zone Descriptor Extension is %sVaild Reset Zone Recommended with Reset Recommended Limit%s Finish Zone Recommended with Finish Recommended Limit%s Zone Finished by ControllerSLBA: %#-10lx WP: %#-10lx Cap: %#-10lx State: %#-4x Type: %#-4x Attrs: %#-4x AttrsInfo: %#-4x dir-receive: type:%#x operation:%#x spec:%#x nsid:%#x result:%#x Identify Directive : %s Stream Directive : %s Data Placement Directive : %s Directive Persistent Across Controller Level Resetsinvalid directive operations for Identify Directives Max Streams Limit (MSL): %u NVM Subsystem Streams Available (NSSA): %u NVM Subsystem Streams Open (NSSO): %u NVM Subsystem Stream Capability (NSSC): %u Stream Write Size (in unit of LB size) (SWS): %u Stream Granularity Size (in unit of SWS) (SGS): %u Namespace Streams Allocated (NSA): %u Namespace Streams Open (NSO): %u Namespace Streams Allocated (NSA): %u invalid directive operations for Streams Directives [5:4] : %#x NPWG, NPWA, %s%sNPDA, and NOWS are %sSupported [2:2] : %#x Deallocated or Unwritten Logical Block error %sSupported [1:1] : %#x Namespace uses %s [0:0] : %#x Thin Provisioning %sSupported NVMe Identify Namespace for LBA format[%d]: [6:5] : %#x Most significant 2 bits of Current LBA Format Selected [4:4] : %#x Metadata Transferred %s [3:0] : %#x Least significant 4 bits of Current LBA Format Selected [1:1] : %#x Metadata Pointer %sSupported [0:0] : %#x Metadata as Part of Extended Data LBA %sSupported [4:4] : %#x Protection Information Transferred as Last Bytes of Metadata %sSupported [3:3] : %#x Protection Information Transferred as First Bytes of Metadata %sSupported [2:2] : %#x Protection Information Type 3 %sSupported [1:1] : %#x Protection Information Type 2 %sSupported [0:0] : %#x Protection Information Type 1 %sSupported [3:3] : %#x Protection Information is Transferred as %s Bytes of Metadata [2:0] : %#x Protection Information %s [4:4] : %#x Guard Field of Deallocated Logical Blocks is set to %s [3:3] : %#x Deallocate Bit in the Write Zeroes Command is %sSupported [2:0] : %#x Bytes Read From a Deallocated Logical Block and its Metadata are %s LBA Format %2d : Metadata Size: %-3d bytes - Data Size: %-2d bytes - Relative Performance: %#x %s %s lbaf %2d : ms:%-3d lbads:%-2d rp:%#x %s NVME Identify NVM Set List %d: NVM Set Attribute Entry[%2d] Domain Id for Attr Entry[%u]: %u Domain Capacity for Attr Entry[%u]: %s Unallocated Domain Capacity for Attr Entry[%u]: %s Max Endurance Group Domain Capacity for Attr Entry[%u]: %s Endurance Group Log for NVME device:%s Group ID:%x NVME Namespace Identification Descriptors NS %d: [3:3] : %#x ANA %ssupported [31:31] : %#x Discovery Log Change Notice %sSupported [27:27] : %#x Zone Descriptor Changed Notices %sSupported [16:16] : %#x Temperature Threshold Hysteresis Recovery %sSupported [15:15] : %#x Normal NSS Shutdown Event %sSupported [14:14] : %#x Endurance Group Event Aggregate Log Page Change Notice %sSupported [13:13] : %#x LBA Status Information Notices %sSupported [12:12] : %#x Predictable Latency Event Aggregate Log Change Notices %sSupported [11:11] : %#x Asymmetric Namespace Access Change Notices %sSupported [9:9] : %#x Firmware Activation Notices %sSupported [8:8] : %#x Namespace Attribute Changed Event %sSupported [19:19] : %#x Flexible Data Placement %sSupported [17:17] : %#x HMB Restrict Non-Operational Power State Access %sSupported [16:16] : %#x MDTS and Size Limits Exclude Metadata %sSupported [15:15] : %#x Extended LBA Formats %sSupported [14:14] : %#x Delete NVM Set %sSupported [13:13] : %#x Delete Endurance Group %sSupported [12:12] : %#x Variable Capacity Management %sSupported [11:11] : %#x Fixed Capacity Management %sSupported [10:10] : %#x Multi Domain Subsystem %sSupported [9:9] : %#x UUID List %sSupported [8:8] : %#x SQ Associations %sSupported [7:7] : %#x Namespace Granularity %sSupported [6:6] : %#x Traffic Based Keep Alive %sSupported [5:5] : %#x Predictable Latency Mode %sSupported [4:4] : %#x Endurance Groups %sSupported [3:3] : %#x Read Recovery Levels %sSupported [2:2] : %#x NVM Sets %sSupported [1:1] : %#x Non-Operational Power State Permissive %sSupported [0:0] : %#x 128-bit Host Identifier %sSupported [1:1] : %#x NVM subsystem %spart of an Enclosure [0:0] : %#x NVM subsystem %spart of a Storage Device [7:7] : %#x VPD Write Cycles Remaining field is %svalid. [6:0] : %#x VPD Write Cycles Remaining [1:1] : %#x NVM subsystem %scontains a Management Endpoint on a PCIe port [0:0] : %#x NVM subsystem %scontains a Management Endpoint on an SMBus/I2C port [10:10] : %#x Lockdown Command and Feature %sSupported [9:9] : %#x Get LBA Status Capability %sSupported [8:8] : %#x Doorbell Buffer Config %sSupported [7:7] : %#x Virtualization Management %sSupported [6:6] : %#x NVMe-MI Send and Receive %sSupported [5:5] : %#x Directives %sSupported [4:4] : %#x Device Self-test %sSupported [3:3] : %#x NS Management and Attachment %sSupported [2:2] : %#x FW Commit and Download %sSupported [1:1] : %#x Format NVM %sSupported [0:0] : %#x Security Send and Receive %sSupported [5:5] : %#x Multiple FW or Boot Update Detection %sSupported [4:4] : %#x Firmware Activate Without Reset %sSupported [3:1] : %#x Number of Firmware Slots [0:0] : %#x Firmware Slot 1 Read%s [6:6] : %#x Telemetry Log Data Area 4 %sSupported [5:5] : %#x LID 0x0, Scope of each command in LID 0x5, 0x12, 0x13 %sSupported [4:4] : %#x Persistent Event log %sSupported [3:3] : %#x Telemetry host/controller initiated log page %sSupported [2:2] : %#x Extended data for Get Log Page %sSupported [1:1] : %#x Command Effects Log Page %sSupported [0:0] : %#x SMART/Health Log Page per NS %sSupported [7:0] : %d (0's based) Error Log Page Entries (ELPE) [7:0] : %d (0's based) Number of Power States Support (NPSS) [0:0] : %#x Admin Vendor Specific Commands uses %s Format [0:0] : %#x Autonomous Power State Transitions %sSupported [15:0] : %s (%u K) Warning Composite Temperature Threshold (WCTEMP) [15:0] : %s (%u K) Critical Composite Temperature Threshold (CCTEMP) Total NVM Capacity (TNVMCAP) Unallocated NVM Capacity (UNVMCAP) [0:0] : %#x Host Controlled Thermal Management %sSupported [15:0] : %s (%u K) Minimum Thermal Management Temperature (MNTMT) [15:0] : %s (%u K) Maximum Thermal Management Temperature (MXTMT) [29:29] : %#x No-Deallocate After Sanitize bit in Sanitize command %sSupported [3:3] : %#x Media Verification and Post-Verification Deallocation state %sSupported [2:2] : %#x Overwrite Sanitize Operation %sSupported [1:1] : %#x Block Erase Sanitize Operation %sSupported [0:0] : %#x Crypto Erase Sanitize Operation %sSupported [7:7] : %#x Non-zero group ID %sSupported [6:6] : %#x Group ID does %schange [4:4] : %#x ANA Change state %sSupported [3:3] : %#x ANA Persistent Loss state %sSupported [2:2] : %#x ANA Inaccessible state %sSupported [1:1] : %#x ANA Non-optimized state %sSupported [0:0] : %#x ANA Optimized state %sSupported [2:0] : %#x Temperature Threshold Maximum Hysteresis [7:4] : %#x Max SQ Entry Size (%d) [3:0] : %#x Min SQ Entry Size (%d) [7:4] : %#x Max CQ Entry Size (%d) [3:0] : %#x Min CQ Entry Size (%d) [10:10] : %#x All Fast Copy %sSupported [9:9] : %#x Copy Single Atomicity %sSupported [8:8] : %#x Copy %sSupported [7:7] : %#x Verify %sSupported [6:6] : %#x Timestamp %sSupported [5:5] : %#x Reservations %sSupported [4:4] : %#x Save and Select %sSupported [3:3] : %#x Write Zeroes %sSupported [2:2] : %#x Data Set Management %sSupported [1:1] : %#x Write Uncorrectable %sSupported [0:0] : %#x Compare %sSupported [0:0] : %#x Fused Compare and Write %sSupported [3:3] : %#x Format NVM Broadcast NSID (FFFFFFFFh) %sSupported [2:2] : %#x Crypto Erase %sSupported as part of Secure Erase [1:1] : %#x Crypto Erase Applies to %s Namespace(s) [0:0] : %#x Format Applies to %s Namespace(s) [0:0] : %#x Volatile Write Cache %sPresent [0:0] : %#x NVM Vendor Specific Commands uses %s Format [2:2] : %#x Permanent Write Protect %sSupported [1:1] : %#x Write Protect Until Power Supply %sSupported [0:0] : %#x No Write Protect and Write Protect Namespace %sSupported [%d:%d] : %#x Controller Copy Format %xh %sSupported [20:20]: %#x Address Offsets %sSupported [19:19]: %#x Metadata Pointer Containing SGL Descriptor is %sSupported [18:18]: %#x SGL Length Larger than Buffer %sSupported [17:17]: %#x Byte-Aligned Contig. MD Buffer %sSupported [16:16]: %#x SGL Bit-Bucket %sSupported [15:8] : %#x SGL Descriptor Threshold [2:2] : %#x Keyed SGL Data Block descriptor %sSupported [1:0] : %#x Scatter-Gather Lists Supported. Dword alignment required. [1:0] : %#x Scatter-Gather Lists Supported. No Dword alignment required. [1:0] : %#x Scatter-Gather Lists Not Supported [0:0] : %#x %s Controller Model [0:0] : %#x Disconnect command %s Supported operational enlat:%d exlat:%d rrt:%d rrl:%d rwt:%d rwl:%d idle_power: active_power_workload: [21:21]: %#x Transport SGL Data Block Descriptor %sSupported Too many zones have changed to fit into the log. Use report zones for changes.associated with PCI Subsystem Vendor ID No admin command for any namespace No other command for same namespace No other command for any namespace Vendor Specific Admin CommandsSupport Log Pages Details for %s: Establish Context and Read 512 Bytes of Header is %s Smart Log for NVME device:%s namespace-id:%x Available Spare[0] : %d Temp. Threshold[1] : %d NVM subsystem Reliability[2] : %d Read-only[3] : %d Volatile mem. backup failed[4] : %d Persistent Mem. RO[5] : %d available_spare_threshold : %u%% endurance group critical warning summary: %#x Data Units Written : %s (%s) Warning Temperature Time : %u Critical Composite Temperature Time : %u Temperature Sensor %d : %s (%u K) Thermal Management T1 Trans Count : %u Thermal Management T2 Trans Count : %u Thermal Management T1 Total Time : %u Thermal Management T2 Total Time : %u The Timestamp field was initialized with a Timestamp value using a Set Features command.The Timestamp field was initialized to ‘0’ by a Controller Level Reset.The controller may have stopped counting during vendor specific intervals after the Timestamp value was initializedThe controller counted time in milliseconds continuously since the Timestamp value was initialized. The timestamp is : %'lu (%s) Num Metadata Element Descriptors: %d get-feature:%#0*x (%s), %s value:%#0*x Extended Idle Period with a Burst of Random WritesNon-deterministic Window (NDWIN)Write Protect Until Power Cycle High Priority Weight (HPW): %u Medium Priority Weight (MPW): %u Low Priority Weight (LPW): %u Arbitration Burst (AB): Number of LBA Ranges (NUM): %u Temperature Threshold Hysteresis(TMPTHH): %s (%u K) Threshold Type Select (THSEL): %u - %s Threshold Temperature Select (TMPSEL): %u - %s Temperature Threshold (TMPTH): %s (%u K) Deallocated or Unwritten Logical Block Error Enable (DULBE): %s Time Limited Error Recovery (TLER): %u ms Volatile Write Cache Enable (WCE): %s Number of IO Completion Queues Allocated (NCQA): %u Number of IO Submission Queues Allocated (NSQA): %u Aggregation Time (TIME): %u usec Aggregation Threshold (THR): %u Discovery Log Page Change Notices : %s Endurance Group Event Aggregate Log Change Notices : %s LBA Status Information Notices : %s Predictable Latency Event Aggregate Log Change Notices : %s Asymmetric Namespace Access Change Notices : %s Telemetry Log Notices : %s Firmware Activation Notices : %s Namespace Attribute Notices : %s SMART / Health Critical Warnings : %s Autonomous Power State Transition Enable (APSTE): %s Idle Time Prior to Transition (ITPT): %u ms Idle Transition Power State (ITPS): %u Enable Host Memory (EHM): %s Host Memory Non-operational Access Restriction Enable (HMNARE): %s Host Memory Non-operational Access Restricted (HMNAR): %s Host Memory Descriptor List Entry Count (HMDLEC): %u Host Memory Descriptor List Address (HMDLAU): %#x Host Memory Descriptor List Address (HMDLAL): %#x Host Memory Buffer Size (HSIZE): %u Keep Alive Timeout (KATO) in milliseconds: %u Thermal Management Temperature 1 (TMT1) : %u K (%s) Thermal Management Temperature 2 (TMT2) : %u K (%s) Non-Operational Power State Permissive Mode Enable (NOPPME): %s Read Recovery Level (RRL): %u Predictable Latency Window Enabled: %s Advanced Command Retry Enable (ACRE): %s Extended Telemetry Data Area 4 Supported (ETDAS): %s LBA Format Extension Enable (LBAFEE): %s Copy Descriptor Format 2h Enabled (CDFE): %s Copy Descriptor Format 3h Enabled (CDFE): %s No-Deallocate Response Mode (NODRM) : %u Endurance Group Identifier (ENDGID): %u Endurance Group Critical Warnings : %u Spinup control feature Enabled: %s Pre-boot Software Load Count (PBSLC): %u Host Identifier (HOSTID): %lu Mask Reservation Preempted Notification (RESPRE): %s Mask Reservation Released Notification (RESREL): %s Mask Registration Preempted Notification (REGPRE): %s Persist Through Power Loss (PTPL): %s Flexible Direct Placement Enable (FDPE) : %s Flexible Direct Placement Configuration Index : %u %-21s %-21s %-20s %-40s %#-10x %-26s %-16s %-8s %-12s %-12s %#-10x %-26s %-16s Operation completed without errorOperation was aborted by a Device Self-test commandOperation was aborted by a Controller Level ResetOperation was aborted due to a removal of a namespace from the namespace inventoryOperation was aborted due to the processing of a Format NVM commandA fatal error or unknown test error occurred while the controller was executing the device self-test operation and the operation did not completeOperation completed with a segment that failed and the segment that failed is not knownOperation completed with one or more failed segments and the first segment that failed is indicated in the SegmentNumber fieldOperation was aborted for unknown reasonOperation was aborted due to a sanitize operationAdditional media modification after sanitize operation completes successfully is not definedMedia is not additionally modified after sanitize operation completes successfullyMedia is additionally modified after sanitize operation completes successfullySupport for the NSID field set to FFFFFFFFh is not indicatedThe Flush command does not support NSID set to FFFFFFFFhThe Flush command supports NSID set to FFFFFFFFh`u vvvu`u`u`u`u`u`u`u`u`u`uu`xwxxpxyxz zy{{{{{{{Ɇ{{{{{{{{{){{{{{{{){{{{{{{{{f{{{{{{{S{{{{{{{y{{{{{{{{{R{{{?{{{{{{{{{{{{{{Ѓ{{{ {{{{{{{{{|LzLzLz|LzLzLz |LzLzLzT{LzLzLzzLzLzLzzLzLzLzzp|$$$$$$$$$$$$$$$$$$$$$$$Տ$$$$$$Ď$$$$$$$$$$ɏ$$$$$$$Ў$$$܎$$$$$$$$$$$$$$$$T$$$$$$$]$$$i$$$u$$$$$$0x  ܝNw!O_>4iJ<qqPNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNlllNstdout_d----------------------------------------------------------------------------------------------------Y@>ꌠ9Y>)Fconnecting to device: %s %-16s %-96s ControllersSubsystem-NQN%-16s %-96s %-.16s %-.16s %-.96s %-.16s MNCntlidSlotAddressTxPortFRNSIDGenericNodeFW Rev +- ns %d \ +- %s %s %s %s %s +- %s %s %s +- ns %d %s %s +- %s %s %s %s +- ns %d %s trtype: %s adrfam: %s subtype: %s treq: %s portid: %d trsvcid: %s subnqn: %s traddr: %s eflags: %s rdma_prtype: %s rdma_qptype: %s rdma_cms: %s rdma_pkey: %#04x sectype: %s %s: 0x%-8s %-6s %-20s %-40s %-8s %-6s %-14s %-6s %-12s %-16s %-5s %-20s %-40s %-8s %-6s %-14s %-6s %-12s %-16s %-.16s %-.6s %-.20s %-.40s %-.8s %-.6s %-.14s %-.6s %-.12s %-.16s %-17s %-17s %-10s %-26s %-16s %-16s %-.17s %-.17s %-.10s %-.26s %-.16s %-.16s %-21s %-21s %-20s %-40s %-10s %-26s %-16s %-8s %-.21s %-.21s %-.20s %-.40s %-.10s %-.26s %-.16s %-.8s Discovery Log Number of Records %d, Generation counter %lu =====Discovery Log Entry %d====== stdout_detailed_ctrlNVMe specification%d secsCRIMTCRWMTNot enabledController Base Address (CBA)mayshall%#x%s/secondRead Data Support (RDS)Write Data Support (WDS)Base Indicator Register (BIR)Not readyHealth Status (HSTS)Not Ready (NRDY)Error (ERR)MayShallRead Bypass Behaviorevent_typedtwin_reads_typicaldtwin_writes_typicaldtwin_time_maximumndwin_time_minimum_highndwin_time_minimum_lowdtwin_reads_estimatedtwin_writes_estimatedtwin_time_estimatern_log_typenum_logsabpidbpszsprogglobal_erasedno_cmplted_passes(%d) %ssstatcdw10_infotime_over_writetime_block_erasetime_crypto_erasetime_over_write_no_dealloctime_block_erase_no_dealloctime_crypto_erase_no_deallocsqidcmdidstatus_fieldphase_tagparm_error_locationnsidtrtypetrtype_spec_infogenregctlptplsregctlsrcstsregctlextchgcntngrpsnnsidsNSIDSANA DESC LIST Feature: %#0*x: selectList of Valid ReportsSelf test resultSelf test codeSegment numberValid Diagnostic InformationPower on hoursNamespace IdentifierFailing LBAStatus Code TypeStatus CodeOnly Admin Command SetI/O Command Set%u bytesDoorbell Stride (DSTRD)%u msTimeout (TO)One or more I/O Command SetsNVM command setBoot Partition Support (BPS)Command Sets Supported (CSS)Controller Power Scope (CPS)num_entries_availentrylist_of_entriesCompletion Condition (CMPC)cmpc-definitionLSD entry %d0x%016lxDSLBA0x%08xNLB0x%02xfid_%ufid_supportmi_cmd_%umi_command_supportnmucchanssel_configmuiddomainidendgidnvmsetidcap_adj_fctravl_sparemucsciomus_listfdpavssnrgnruhnnssrunserutlruhtconfigsruharuhusfdpeftimestampnlbamnruhsdruhidearutrruamwruhssnsfeatnlbafdpcrescapdlfeatnawunnawupfnacwunabsnnabonabspfnoiobnsattrnpwgnpwanpdgnpdanowsmssrlmclmsrcnulbafcritical_warningendurance_group_featuresavl_spare_thresholddomain_identifierendurance_estimatedata_units_readdata_units_writtenhost_read_cmdshost_write_cmdsmedia_data_integrity_errnum_err_info_log_entriestotal_end_grp_capunalloc_end_grp_capavailable_sparetemp_thresholdreliability_degradedvmbu_failedpmr_roavail_sparespare_threshhost_read_commandshost_write_commandscontroller_busy_timepower_cyclespower_on_hoursunsafe_shutdownsmedia_errorsnum_err_log_entrieswarning_temp_timecritical_comp_timetemperature_sensor_%dthm_temp1_trans_countthm_temp2_trans_countthm_temp1_total_timethm_temp2_total_timesccnCapacity Descriptorcap_config_idegcnEndurance Descriptorcap_adj_factortegcapsegcapegsetsegchansChannel DescriptorNVM Set IDschanidchmusMedia DescriptorhbmwmbmwmbeActive Firmware Slot (afi)Firmware Rev Slot %d%lu (%s)Changed Namespace List Log[%4u]%-.*sfrrabieeecmicmdtsrtd3rrtd3eoaesctrattrrlscntrltypefguidcrdt1crdt2crdt3nvmsrvwcimecoacsaclaerlfrmwlpaelpenpssavsccapstawctempcctempmtfahmprehmmintnvmcapunvmcaprpmbsedsttdstofwugkashctmamntmtmxtmtsanicaphmmindshmmaxdnsetidmaxendgidmaxanattanacapanagrpmaxnanagrpidpelsmegcaptmpthhasqescqesmaxcmdnnoncsfusesfnavwcicsvsccnwpcocfssglsmnanmaxdnamaxcnaoaqdsubnqnioccsziorcszicdofffcattmsdbdofcspsdsmax_powermax_power_scalenon-operational_stateentry_latexit_latread_tputread_latwrite_tputwrite_latidle_poweridle_scaleactive_poweractive_power_workactive_scaleShutdown Notification (SHN)Memory Page Size (MPS)Enable (EN)Shutdown Status (SHST)Ready (RDY)Controller Fatal Status (CFS)Processing Paused (PP)Shutdown Type (ST)Boot Read Status (BRS)Boot Partition Size (BPSZ)0x%0*xunknown propertycommand_set_identifierACS_%u (%s)admin_cmd_setIOCS_%u (%s)io_cmd_setlog_idtotal_num_of_eventstotal_log_lenlog_revisionlog_header_lenpower_cycle_countpci_vidpci_ssvidgen_numberrcibitmap_%xSupport %seomiphsizersizeeomdgnlanesepllspfclsicdsizemaxtbmaxlretgoodetbetteretbestlanetopbottomrightnrowsncolsedlenprintable_eyeHostNQNHostIDIOPolicyTransportANAStatePathsSubsystems%s: algorithm name overflowsocketbindsetsockoptacceptcallocFailed to open %s: %s md5Operation successfulGeneral failureAuthentication (MAC) failureUnknown error%s ! Expired write-counter ! %s ! %s %s-%s usage: %s %s %s usage: %s %s %-*s %s Shows the program versionDisplay this helpn/a%s %s %s [OPTIONS]%s-%s-%sman2.11%s %s version %s (git %s) nvme_get_versionlibnvme version %s (git %s) ResultCould not allocate stringSize (SZ)Size Units (SZU)PRP SGL List Support (LISTS)list_of_event_entriesevent_numberevent_type_revevent_header_lenevent_header_additional_infoctrl_idevent_time_stampvu_info_lenevent_lenold_fw_revnew_fw_revfw_commit_actionfw_slotsct_fwsc_fwvu_assign_fw_commit_rcprev_tsml_secs_since_resetfw_actop_in_progctrl_power_cyclepower_on_ml_secsctrl_time_stampnss_hw_err_codensmgt_cdw10nscapana_grp_idformat_nvm_cdw10smallest_fpiformat_nvm_statuscompln_infoSANICAPsani_cdw10sani_cdw11sani_progsani_statuscmpln_infocreateover_templslplennlslneestulblsgcneidnlrdratyperslbarnlbns_elementsregister: %#04x%#lx%#04x (%s)Controller Memory Space Enable (CMSE)Capabilities Registers Enabled (CRE)CMB Elasticity Buffer Size Base (CMBWBZ)CMB Elasticity Buffer Size Units (CMBSZU)CMB Read Bypass Behavior (CMBRBB)CMB Sustained Write Throughput (CMBSWTV)CMB Sustained Write Throughput Units (CMBSWTU)Persistent Memory Region Time Units (PMRTU)Controller Memory Space Supported (CMSS)Persistent Memory Region Timeout (PMRTO)Persistent Memory Region Write Barrier Mechanisms (PMRWBM)Controller Base Address Invalid (CBAI)PMR Elasticity Buffer Size Base (PMRWBZ)PMR Elasticity Buffer Size Units (PMRSZU)Admin Completion Queue Size (ACQS)Admin Submission Queue Size (ASQS)Boot Partition Identifier (BPID)Boot Partition Read Offset (BPROF)Boot Partition Read Size (BPRSZ)I/O Command Set Combination[%u]Asymmetric Namespace Access Log for NVMe deviceCurrent Device Self-Test OperationCurrent Device Self-Test CompletionContiguous Queues Required (CQR)Maximum Queue Entries Supported (MQES)NVM Subsystem Reset Supported (NSSRS)Arbitration Mechanism Supported (AMS)Persistent Memory Region Supported (PMRS)Memory Page Size Maximum (MPSMAX)Memory Page Size Minimum (MPSMIN)Controller Memory Buffer Supported (CMBS):NVM Subsystem Shutdown Supported (NSSS)Controller Ready Independent of Media Support (CRIMS)Controller Ready With Media Support (CRWMS)NVM Subsystem Shutdown Enhancements Supported (NSSES)Number of LBA Status Descriptors (NLSD)No indication of the completion conditionCompleted transferring the amount of data specified in theMNDW field. But, additional LBA Status Descriptor Entries areavailable to transfer or scan did not complete (if ATYPE = 10h)Completed the specified action over the number of LBAs specifiedin the Range Length field and transferred all available LBA StatusDescriptor Entriesendurance_grp_critical_warning_summaryArbitration Mechanism Selected (AMS)I/O Command Set Selected (CSS)Controller Ready Independent of Media Enable (CRIME)I/O Completion Queue Entry Size (IOCQES): I/O Submission Queue Entry Size (IOSQES)NVM Subsystem Reset Occurred (NSSRO)Active Boot Partition ID (ABPID)PMR Sustained Write Throughput (PMRSWTV)PMR Sustained Write Throughput Units (PMRSWTU)NVM Subsystem Reset Control (NSSRC)NVM Subsystem Shutdown Control (NSSC)Failed to read data from file %s with %s No memory for reading file :%s Memory allocation failed for request 0x%04x Counter failure (not matching/incrementing failure)Address failure (out of range or wrong alignment)Write (data/counter/result) failureRead (data/counter/result) failureAuthentication key not yet programmedInvalid device configuration block%s ! non-matching response 0x%04x for 0x%04x failed to allocate RPMB config buffer The following are all implemented sub-commands:See '%s %s help ' for more information on a specific command See '%s help ' for more information on a specific command The following are all installed plugin extensions: See '%s help' for more information on a plugin ERROR: Invalid sub-command '%s' for plugin %s ERROR: Invalid sub-command '%s' Controller Memory Buffer feature is not supportedSubmission Queue Support (SQS)Completion Queue Support (CQS)Number of LBA Range Descriptors (NLRD) set to %#x for NS element %dInterrupt Vector Mask Set (IVMS)Interrupt Vector Mask Clear (IVMC)Admin Submission Queue Base (ASQB)Admin Completion Queue Base (ACQB)Boot Partition Memory Buffer Base Address (BMBBA)Interrupt Vector Mask Set (IVMC)xĚ,,,,,,,,,,,,,,,,,,,,,,,,,,,,$@P@`p%4$|$3\)\)\)\)\)\)\)2\)\)\)2\)\)\)u2\)\)\)V2\)\)\)\)\)\)\)72\)\)\)2\)\)\)1\)\)\)1\)\)\)\)\)\)\)Q1\)\)\)\)\)\)\)0\)\)\)0\)\)\)[0\)\)\)0\)\)\)v/\)\)\)\)\)\)\)9/\)\)\)\)\)\)\).\)\)\)P.\)\)\).\)\)\)-\)\)\)Y-H*''')'''X)''')'''x+'''*'''h(create_hashNo notification;Normal shutdown Abrupt shutdown Weighted Round Robin with Urgent Priority ClassVendor SpecificNormal operation (no shutdown has been requestedShutdown processNo Boot Partition read operationBoot Partition read in progressead completed suError completing Boot Partition nstatvslwzslwusldmrldmrsldmslaocs[15:1]: Reservedzaslnr_zoneszone_listportidcrtvqfrtvqrfavqrfapvqprtvqfrsmvqgranvifrtvirfavirfapviprtvifrsmvigranpicpifaelbafsqpifnpdglnprgnpranorsnpdallbapsstlbaagzocozcsmarmorrrlfrlzrwafgzrwaszzrwacaplbafezszezdesnsid_listnum_ctrlctrl_listprimary-controller-identifiersecondary-controller-statevirtual-function-numbernum-virtual-queuesnum-virtual-interruptssecondary-controllersattributesnum-descriptorsnamespace-size-granularitynamespace-granularity-listnum_endgrp_idendgrp_listlid_0x%x supported_logsnidtnidlLBA RangesLBA rangetype descriptionattribute[1]attribute[0][31:24]: Access Size[23:16]: Total Size[15:6]: Reserved[5:3]: Authentication Method[2:0]: Number of RPMB Unitsnrzidzid %03dMax Streams Limit (MSL)Namespace Streams Open (NSO)Open Stream CountStream Identifier %.6uData Placement DirectiveStream DirectiveIdentify Directivewpext_dataNot validattrs_infoMetadata Element DescriptorsElementType definitionfeature: %#0*xFeature: %#0*xHigh Priority Weight (HPW)Medium Priority Weight (MPW)Low Priority Weight (LPW)Arbitration Burst (AB)Workload Hint (WH)WH descriptionPower State (PS)Number of LBA Ranges (NUM)%u KTMPTHH kelvinThreshold Type Select (THSEL)THSEL descriptionTMPSEL descriptionTemperature Threshold (TMPTH)TMPTH kelvin%u usecAggregation Time (TIME)Aggregation Threshold (THR)%2dtimestamp stringTMT1 celsiusTMT2 celsiusRead Recovery Level (RRL)Enable EventDTWIN Reads ThresholdDTWIN Writes ThresholdDTWIN Time ThresholdWindow SelectHost Identifier (HOSTID)Coalescing Disable (CD)Interrupt Vector (IV)Disable Normal (DN)Namespace Attribute NoticesFirmware Activation NoticesTelemetry Log NoticesEnable Host Memory (EHM)synchtimestamp originHost Behavior SupportNVMSetendurance_group_idrandom_4k_read_typicaloptimal_write_sizetotal_nvmset_capunalloc_nvmset_capnum_dom_entriesdomain_listdom_idunalloc_dom_capmax_egrp_dom_capassociationUUID-listNameSpaceDevicePathGenericPathModelNumberSerialNumberUsedBytesMaximumLBAPhysicalSizeSectorSizeSubsystemNQNDevicesgenctrrecordsadrfamsubtypeeflagsrdma_prtyperdma_qptyperdma_cmsrdma_pkeysectypetreqstatus: %dnvme-miError: %s../ccan/ccan/htable/htable.ci > 0bdevbdev : %s Dump output in binary formatDump output in json formatIntel Smart logprogram_fail_counterase_fail_countwear_levelingcrc_error_counttimed_workload_media_weartimed_workload_host_readstimed_workload_timerthermal_throttle_statusretry_buffer_overflow_countpll_lock_loss_countnand_bytes_writtenhost_bytes_writtensystem_area_life_remainingnand_bytes_readcurpower_consumptionpower_on_temperaturepower_loss_protectionread_fail_countthermal_throttle_timeflash_error_media_countlifetime_write_amplificationfirmware_update_countdram_cecc_countdram_uecc_countxor_pass_countxor_fail_countxor_invoked_countinflight_read_io_cmdtemp_since_borntemp_since_bootupinflight_write_io_cmdDevice stats0x%04x%04x%04xarray_name : %s array_ver : %s array_namearray_verCriticalGet the Dera device statusEndurance group identifierhost-eventsGet host eventsNo information providedNot enforcedht->elems != 0Namespace identifierReclaim Unit Handle StatusInitial LowRuntime LowQuick RebuildingFull RebuildingRaw RebuildingCard Read OnlyFatal ErrorLow Level FormatFirmware CommittingOver Temperature[0:0]: Reporting Allocated LBA SupportedLBA Status Information Poll Interval (LSIPI)LBA Status Information Report Interval (LSIRI)secondary-controller-identifiernamespace-capacity-granularityNVM Subsystem Streams Available (NSSA)NVM Subsystem Streams Open (NSSO)NVM Subsystem Stream Capability (NSSC)Stream Write Size (in unit of LB size) (SWS)Stream Granularity Size (in unit of SWS) (SGS)Namespace Streams Allocated (NSA)Directive Persistent Across Controller Level Resetsdata: buf=%p len=%d width=%d group=%dNum Metadata Element DescriptorsThe controller may have stopped counting during vendor specific intervals after the Timestamp value was initialized.The Timestamp field was initialized to 0h by a Controller Level Reset.Temperature Threshold Hysteresis (TMPTHH)Threshold Temperature Select (TMPSEL)Number of IO Completion Queues Allocated (NCQA)Number of IO Submission Queues Allocated (NSQA)Idle Time Prior to Transition (ITPT)Idle Transition Power State (ITPS)Host Memory Descriptor List Entry Count (HMDLEC)Host Memory Descriptor List Address (HMDLAU)Host Memory Descriptor List Address (HMDLAL)Host Memory Buffer Size (HSIZE)Keep Alive Timeout (KATO) in millisecondsThermal Management Temperature 1 (TMT1)Thermal Management Temperature 2No-Deallocate Response Mode (NODRM)Endurance Group Critical WarningsPre-boot Software Load Count (PBSLC)Deallocated or Unwritten Logical Block Error Enable (DULBE)Time Limited Error Recovery (TLER)Volatile Write Cache Enable (WCE)SMART / Health Critical WarningsAsymmetric Namespace Access Change NoticesPredictable Latency Event Aggregate Log Change NoticesLBA Status Information NoticesEndurance Group Event Aggregate Log Change NoticesDiscovery Log Page Change NoticesAutonomous Power State Transition Enable (APSTE)Host Memory Non-operational Access Restricted (HMNAR)Host Memory Non-operational Access Restriction Enable (HMNARE)Non-Operational Power State Permissive Mode Enable (NOPPME)Predictable Latency Window EnabledSpinup control feature EnabledFlexible Direct Placement Enable (FDPE)Flexible Direct Placement Configuration IndexMask Registration Preempted Notification (REGPRE)Mask Reservation Released Notification (RESREL)Mask Reservation Preempted Notification (RESPRE)Persist Through Power Loss (PTPL)Get DapuStor vendor specific additional smart log, and show it.end_to_end_error_detection_countAdditional Smart Log for NVME device:%s namespace-id:%x key normalized rawprogram_fail_count : %3d%% %lu erase_fail_count : %3d%% %lu wear_leveling : %3d%% min: %u, max: %u, avg: %u end_to_end_error_detection_count: %3d%% %lu crc_error_count : %3d%% %lu timed_workload_media_wear : %3d%% %.3f%% timed_workload_host_reads : %3d%% %lu%% timed_workload_timer : %3d%% %lu min thermal_throttle_status : %3d%% %u%%, cnt: %u retry_buffer_overflow_count : %3d%% %lu pll_lock_loss_count : %3d%% %lu nand_bytes_written : %3d%% sectors: %lu host_bytes_written : %3d%% sectors: %lu system_area_life_remaining : %3d%% %lu nand_bytes_read : %3d%% %lu temperature : %3d%% min: %u, max: %u, cur: %u power_consumption : %3d%% min: %u, max: %u, avg: %u power_on_temperature : %3d%% min: %u, max: %u, cur: %u power_loss_protection : %3d%% %lu read_fail_count : %3d%% %lu thermal_throttle_time : %3d%% %lu flash_error_media_count : %3d%% %lu lifetime_write_amplification : %3d%% %lu firmware_update_count : %3d%% %lu dram_cecc_count : %3d%% %lu dram_uecc_count : %3d%% %lu xor_pass_count : %3d%% %lu xor_fail_count : %3d%% %lu xor_invoked_count : %3d%% %lu inflight_read_io_cmd : %3d%% %lu temp_since_born : %3d%% min: %u, max: %u, cur: %u temp_since_bootup : %3d%% min: %u, max: %u, cur: %u inflight_write_io_cmd : %3d%% %lu device_status : %s %d%% completed device_status : %s dev_status_up : %s cap_aged : %s cap_aged_ratio : %d%% cap_status : %s cap_voltage : %d mV nand_erase_err_cnt : %d nand_program_err_cnt : %d ddra_1bit_err : %d ddra_2bit_err : %d ddrb_1bit_err : %d ddrb_2bit_err : %d ddr_err_bit : %d pcie_corr_err : %d pcie_uncorr_err : %d pcie_fatal_err : %d power_level : %d W current_power : %d mW nand_init_fail : %d fw_loader_version : %.*s uefi_driver_version : %.*s pcie_volt_status : %s pcie_volt_status : Unknowncurrent_pcie_volt : %d mV init_pcie_volt_low_cnt : %d rt_pcie_volt_low_cnt : %d temp_sensor_abnormal_cnt : %d nand_read_retry_fail_cnt : %d fw_slot_version : %.*s Get Flexible Data Placement Configurationsendurance group identifier required Get Flexible Data Placement Reclaim Unit Handle UsageGet Flexible Data Placement StatisticsGet Flexible Data Placement EventsOffset (OFST) (See cmbsz.szu for granularity)CMB Queue Dword Alignment (CQDA)CMB Queue Mixed Memory Support (CQMMS)CMB Queue Physically Discontiguous Support (CQPDS)CMB Data Pointer Mixed Locations Support (CDPMLS)CMB Data Pointer and Command Independent Locations Support (CDPCILS)CMB Data Metadata Mixed Memory Support (CDMMMS)--+--7888877777777888>?H@nO7MNL@LLLEE0GYHIJJK@@AA:BvBBBC>>5CC>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>t?t?t?CCEED =|=4>ZM#KLI,JnJJCCEEF~GHHI>>??&@b@@@@ = =!AA = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =`=`=`=qAA CCBfdp_statusget_statusdapustor_additional_smart_logunset_another_common_bitupdate_common_fix_invalid_:Memblaze power managementMemblaze clear error loglatstatsvaluesarray name : %s array nameoutput eventlog file : %s a+total eventlog : %d.%d MB get eventlog : %d.%d MB (error)(invalid data error) get eventlog : %d.%d MB get eventlog by vsc commandGet the Inspur vendor logcommit id : %s DM%d read err lba: [%d]lba : %lu clsnlwwwmic_blmic_fwss : %d health : %s cls : %d nlw : %d scap : %d sstat : %d bl : %s ww : %s mic_bl : %s mic_fw : %s Intel Marketing Name Log: %s Invalid IDwear_leveling_counte2e_error_detect_countmedia_wear_percentagetimed_work_loadretry_buff_overflow_countpll_lock_loss_counterhost_context_wear_usedperformance_status_indicatormedia_bytes_readavailable_fw_downgradesre-allocated_sector_countsoft_ecc_error_rateunexpected_power_loss%Lfhost_ctx_wear_usedperf_stat_indicatorre_alloc_sectr_cntsoft_ecc_err_rateunexp_power_lossavail_fw_downgradesEnable LSTDisable LSTEnable latency tracking0.09.0300%c.%c%c.%c%c%c%cP5920%s:%s %s:%x %-34s%-11s%s %-32s: %3d%% %lu , avg: , max: %-31s: %3d%% %lu %-32s: %3d%% %.3f%% %-32s: %3d%% %lu%% %-32s: %3d%% %lu%s , cnt: %-32s: %3d%% %u%%%s%lu sectors: %-32s: %3d%% %s%lu system_area_life_lefttotal_readtempt_since_born, curr: , min: tempt_since_bootupflash_media_errorErase Fail Count : %llu Read Fail Count : %llu 2.130,0input parametersGet Memblaze high latency logw+log_c3.csvMemblaze High Latency Log Major Revision : %d Minor Revision : %d Version: %u %-12s%-36s%-12s%s %#-12x%-36s%-12dmin: %d, max: %d, avg: %d max: %d, min: %d, curr: %d Version %d: N/A sel-perf-logset-commands-maskset-read-thresholdset-write-thresholdset-trim-thresholdMonitor Read command = %d Monitor Write command = %d Monitor Trim command = %d Threshold for Read = %dms Threshold for Write = %dms Threshold for Trim = %dms Reclaim Unit Handle Updatecould not parse pidsno placement identifiers set update: Successplacement-handlePlacement HandleEnable/disable eventevent-typesEnable or disable FDP eventscould not parse event typesno event types set get-namespace-id: %s set-events: Successno cdump data %s Wait for dump data %d%%Querying thresholds failed. value in usUnsupported revision (%u.%u) EndBucket%-12s%-12s%-12s%-20s EventLogAssertLogregionnlognumNamespace to get logs fromverbose-nlog%s_%-.*s.binwrite failureintel logSuccessfully wrote log to %s Unsupported command Invalid select flag no firmware file provided No memory for f/w size:%d %-*.*sOutput Format: normal|json/dev/dev/%sCannot open device %s: %s Huawei/dev/nvme%dNS NameArray NameNS IDNguid%4.2f%send_to_end_error_countretry_buffer_overflow_countercrc_err_countreallocated_sector_countuncorrectable_sector_countnand_uecc_detectionnand_xor_correctiongc_countdram_uecc_detection_countsram_uecc_detection_countinflight_cmdsinternal_e2e_err_countdie_fail_countwear_leveling_execution_countread_disturb_countdata_retention_countcapacitor_healthext_e2e_err_countSet Memblaze power management status (value 0 - 25w, 1 - 20w, 2 - 15w)set-feature:%02x (%s), value:%#08x Clear Memblaze devices error log.Recrieve event log for the given device %s/eventlog_%02d%02d-%02d%02d%02d.erawdevice_state : [healthy]device_state : [warning]mcu data id(mcu) : 0x%x power_info(mcu) : %u mW voltage_info(mcu) : %u mV current_info(mcu) : %u mA history max_power(mcu) : %u mW disk_max_temper(mcu) : %d C disk_overtemper_cout(mcu) : %u ctrl_max_temper(mcu) : %d C ctrl_overtemper_cout(mcu) : %u nand_max_temper(mcu) : %d C nand_overtemper_cout(mcu) : %u temperature[%d](mcu) : %d C CAP Time from 32v to 27v(mcu) : %u ms CAP Time from 27v to 10v(mcu) : %u ms cap_health_state(mcu) : %u warning bit(mcu) : 0x%x%08x -->high_format_fail : %x -->low_format_fail : %x -->current sensor : %x -->nand temp sensor : %x -->board temp sensor : %x -->cntl temp sensor : %x -->cap_timer_test_fail : %x -->readOnly_after_rebuild : %x -->firmware_loss : %x -->cap_self_test : %x -->spare_space_warning : %x -->lifetime_warning : %x -->temp_high_warning : %x -->temp_low_warning : %x -->mcu_disable(mcu) : %x warning history bit(mcu) : 0x%x%08x [%d]nand_bytes_written : %lu GB [%d]io_apptag_err : %u [%d]io_guard_err : %u [%d]io_reftag_err : %u [%d]io_read_fail_cout : %u [%d]io_write_fail_cout : %u [%d]io_dma_disable_err : %u [%d]io_dma_fatal_err : %u [%d]io_dma_linkdown_err : %u [%d]io_dma_timeout_err : %u [%d]lba_err[0] : %u [%d]lba_err[1] : %u [%d]lba_err[2] : %u [%d]lba_err[3] : %u [%d]lba_err[4] : %u [%d]lba_err[5] : %u temp_throttle_per : %u port0_flreset_cnt : %lu port0_hot_reset_cnt : %lu port0_func_reset_cnt : %lu port0_linkdown_cnt : %lu port0_ctrl_reset_cnt : %lu ces_RcvErr_cnt : %u ces_BadTlp_cnt : %u ces_BadDllp_cnt : %u ces_Rplyover_cnt : %u ces_RplyTo_cnt : %u ces_Hlo_cnt : %u scan doorbell err cnt : %u doorbell interrupt err cnt : %u ------------ncm-----------------------------------part%d----------------------- [%d]nand_rd_unc_count : %u [%d]nand_rd_srr_count : %u [%d]nand_rd_sdecode_count : %u [%d]nand_rd_rb_fail_count : %u [%d]nand_prg_fail_count : %u [%d]nand_eras_fail_count : %u [%d]nand_rd_count : %lu [%d]nand_prg_count : %lu [%d]nand_eras_count : %lu [%d]BE_scan_unc_count : %u [%d]rebuild_req_cnt : %u [%d]retry_req_cnt : %u [%d]retry_success_cnt : %u [%d]prg_badblk_num : %u [%d]eras_badblk_num : %u [%d]read_badblk_num : %u [%d]temp_ctrl_limit_count : %u [%d]temp_ctrl_stop_count : %u ------------wlm-----------------------[%d]fbb_count : %u [%d]ebb_count : %u [%d]lbb_count : %u [%d]gc_read_count : %u [%d]gc_write_count : %u [%d]gc_write_fail_count : %u [%d]force_gc_count : %u [%d]avg_pe_count : %u [%d]max_pe_count : %u [%d]free_blk_num1 : %u [%d]free_blk_num2 : %u ------------lkm-----------------------[%d]e2e_check_err_count1 : %u [%d]e2e_check_err_count2 : %u [%d]e2e_check_err_count3 : %u [%d]e2e_check_err_count4 : %u %02X%02X%02X%02X%02X%02X%02X%02XGet Intel Marketing Name log and show it.Get Temperature Statistics log and show it. Intel Temperature Statistics--------------------------------Current temperature : %lu Last critical overtemp flag : %lu Life critical overtemp flag : %lu Highest temperature : %lu Lowest temperature : %lu Max operating temperature : %lu Min operating temperature : %lu Estimated offset : %lu Get Intel vendor specific additional smart log (optionally, for the specified namespace), and show it.ID KEY Normalized Raw%#x %-45s %3d %lu Enable/Disable Intel Latency Statistics Tracking. No argument prints current status.Cannot enable and disable simultaneously.Latency Statistics Tracking (FID 0x%X) is currently (%i). Could not read feature id 0xE2.Command failed while parsing. Successfully set enable bit for FID (0x%X) to %i. Get Memblaze power management ststus (value 0 - 25w, 1 - 20w, 2 - 15w)get-feature:0x%02x (%s), %s value: %#08x Enable/Disable Latency Statistics Tracking. No argument prints current status.Get Memblaze vendor specific additional smart log, and show it.Additional Smart Log for NVME device%-31s : %3d%% %s%u%s%u%s%u %-32s: %3d%% %s%u%s%u%s%u Total write in GB since last factory reset : %lu Total read in GB since last factory reset : %lu Thermal throttling status[1:HTP in progress] : %u Total thermal throttling minutes since power on : %u Maximum temperature in kelvins since last factory reset : %u Minimum temperature in kelvins since last factory reset : %u Maximum temperature in kelvins since power on : %u Minimum temperature in kelvins since power on : %u Current temperature in kelvins : %u Maximum power in watt since power on : %u Minimum power in watt since power on : %u Current power in watt : %u Power loss protection normalized value : %u Percentage of wearleveling count left : %u Wearleveling count min erase cycle : %u Wearleveling count max erase cycle : %u Wearleveling count avg erase cycle : %u Total host write in GiB since device born : %llu Thermal throttling count since device born : %u PCIE Correctable Error Count of Port0 : %llu PCIE Correctable Error Count of Port1 : %llu End-to-End Error Detection Count : %llu Program Fail Count : %llu %-32s : %3d%% %lu %-31s : %3d%% %s%u%s%u%s%u Set Memblaze high latency log input parameter p1,p2 p1 value: 0 is disable, 1 is enable p2 value: 1 .. 5000 mssetfeature: invalid formats %s setfeature: invalid high io latency threshold %d set-feature:0x%02X (%s), value:%#08x --------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------Timestamp Type QID CID NSID StartLBA NumLBA Latency Timestamp Type QID CID NSID StartLBA NumLBA Latency%4d%02d%02d--%02d:%02d:%02d.%03d UTC%-32s %-7x %-6x %-6x %-8x %4x%08x %-8x %-d Get write statistics (read default)Get Latency Statistics log and show it.Memblaze IO Read Command Latency Histogram Memblaze IO Read Command Latency HistogramMemblaze IO Write Command Latency Histogram Memblaze IO Write Command Latency Histogram-------------------------------------------------- --------------------------------------------------Bucket Start End Value Bucket Start End ValueUnsupported io latency histogram revision Unsupported io latency histogram revisiondump the whole log buffer in binary formatAdditional Smart Log for NVMe device: %s max: %d °C (%d K), min: %d °C (%d K), curr: %d °C (%d K) Version %d: Not supported yet Select features to turn on, default: Disable bit 0: latency statistics bit 1: high latency log bit 2: Performance statSet Enable, default: Disable bit 0: Read commands bit 1: high Write commands bit 2: De-allocate/TRIM (this bit is not worked for Performance stat.)set read high latency log threshold, it's a 0-based value and unit is 10msset write high latency log threshold, it's a 0-based value and unit is 10msset trim high latency log threshold, it's a 0-based value and unit is 10ms%s have done successfully. result = %#x. latency statistics enable status = %d high latency enable status = %d performance stat enable status = %d Comma-separated list of placement identifiers to updateComma-separated list of event typestoo many event types (max 255) Recrieve cdump data for the given device cdump_%02d%02d-%02d%02d%02d_%d_%s.cdpcdump_%02d%02d-%02d%02d%02d.cdpGet Intel Latency Statistics log and show it.Unsupported minor revision (%u.%u) Average latency since last resetIntel IO %s Command Latency Statistics Major Revision : %u Minor Revision : %u Average latency since last reset: %lu us Log type: 0, 1, or 2 for nlog, event log, and assert log, respectively.Select which region log should come from. -1 for allSelect which nlog to read. -1 for all nlogsOutput file; defaults to device name providedTo print out verbose nlog infoGet Intel Firmware Log and save it.Log major:%d minor:%d header:%d size:%d Log major:%d minor:%d header:%d size:%d numcores:%d Version Major %u Version Minor %u Log_select %u totalnlogs %u nlognum %u nlogname %u nlogbytesze %u nlogprimarybuffsize %u tickspersecond %u corecount %u nlogpausestatus %u selectoffsetref %u selectnlogpause %u selectaddedoffset %u nlogbufnum %u nlogbufnummax %u coreselected %u Set write bucket Thresholds for latency tracking (read default)Bucket Threshold List, comma separated list: 0, 10, 20 ...Write Intel Bucket Thresholds for Latency Statistics TrackingQuerying media version failed. ERROR: Bucket list is malformed FW Select (e.g., --select=OOB, EEP, ALL)This performs a selective firmware download, which allows the user to select which firmware binary to update for 9200 devices. This requires a power cycle once the update completes. The options available are: OOB - This updates the OOB and main firmware EEP - This updates the eeprom and main firmware ALL - This updates the eeprom, OOB, and main firmwareInvalid size:%d for f/w image Update successful! Please power cycle for changes to take effect Retrieve basic information for the given huawei devicecan not allocate controller list payload %-*.*s %-*.*s %-*.*s %-*.*s %-*.*s %-*.*s %-.*s %-.*s %-.*s %-.*s %-.*s %-.*s %-*.*s %-*.*s %-*.*s %-*d %-*.*s %-*.*s internal_raid_recovery_fail_countui]QE90' ߙmb_get_latency_featuremb_set_latency_featuremb_get_smart_log_addmb_set_lat_statsmemblaze_clear_error_logmb_lat_stats_log_printmb_selective_downloadmb_high_latency_log_printmb_set_high_latency_logmb_set_powermanager_statusmb_get_powermanager_statusmb_get_additional_smart_logset_lat_stats_thresholdsenable_lat_stats_trackingget_internal_logget_lat_stats_logget_temp_stats_logget_market_logget_additional_smart_lognvme_get_vendor_loginnogrit_vsc_getcdumpgetvsc_eventloggetvsctypefdp_set_eventsfdp_updatezD$tI??----------------End(<)Start(>=)%-12s%-12s%-12s%-12s %-12u%-12s%-12s%-12u OpCQIDFUAPInfoDTypeCIDPSDTFuse%Y-%m-%d %H:%M:%S%s.%03d%-24s%-12u%#-6x%-6u%-24ludurationTimestamp %2d: %s.%03d Avg-Read-Latency(us)Read-Bandwidth(MiB)Read-IOs(K)EntryMax-Write-Latency(us)Avg-Write-Latency(us)Write-Bandwidth(MiB)Write-IOs(K)Max-Read-Latency(us)Read-Bandwidth(KiB)Read-IOs(IOPS)Write-Bandwidth(KiB)Write-IOs(IOPS)ab+%.2f%sBcolumnoutput format normal|%lu:%u:%u| %lu| %s| %d| Fail #%dDEAC, PRINFO, FUA, LRList the supported log pages%02Xh : %s Support Log PagesDevice Self TestCommand and Feature lockdownRotational Media InformationSMART Cloud Health LogFirmware Activation HistoryLatency Monitor Loghottest componentcompositeenable or disable or status for All commands for TrimClear FW activation historyoutput format normal|json Device not found%u CCurrent Composite Temperature%-10s : %u C /dev/nvmeInvalid device specified!/sys/block/%s/deviceFailed to read device../../nvme/sys/block/%s/device/device/%x:%x:%x.%xFailed to clear error count0x%lx%016lx%-40s : %s Get drive HW informationMicron Drive HW Information%u.%uDrive Hardware Version%u KBFTL_unit_sizeBoot Spec.VersionFTL_unit_size: %u KB Boot Spec.Version: %u.%u %u%s%2d %8s %8s %8lu /vol/nvme%dn%dp%d,%d%u%sByesnoINVALIDOutput format: normal|jsonshow NBFT subsystemshfishow NBFT HFIsdiscovery(empty) NBFT Subsystems: IdxSvcIdTrsp NBFT HFIs: MAC AddrPCI AddrDNSGatewayIP AddrDHCP%02x:%02x:%02x:%02x:%02x:%02x NBFT Discovery Controllers: URI%-3.3s|%-*.*s|%-*.*s %-.3s+%-.*s+%-.*s %-3d|%-*.*s|%-*.*s filenamehost_id_configuredhost_nqn_configuredprimary_admin_host_flaghostnum_hfissubsys_port_idnid_typecontroller_idsubsys_nqnasqszpdu_header_digest_requireddhcp_root_path_stringdata_digest_requireddiscoveredunavailablepcidevmac_addrvlanip_originsubnet_mask_prefixgateway_ipaddrroute_metricprimary_dns_ipaddrthis_hfi_is_default_routehost_namedhcp_overridesecurityuridhcp_server_ipaddrsecondary_dns_ipaddrVserverNamespace_PathUUIDLBA_SizeNamespace_SizeNo NVMe devices detected Invalid device name %s Unable to open %s: %s NetApp E-SeriesVolume NameAccess StateCtrlVolume IDNo smdevices detected NetApp ONTAP Controllerioctl error %0x Namespace Path-------------------------No ontapdevices detected ECRC Error Status (ECRCES)Malformed TLP Status (MTS)Completer Abort Status (CAS)Poisoned TLP Status (PTS)Bad DLLP Status (BDS)Bad TLP Status (BTS)Receiver Error Status (RES)output format json|normalRetrieve PCIe event countersPCIE Stats%-42s : %-1hu %-42s : %-1d PCIE Stats:SMART Extended Log:0xE1firmware_slot_info_log.binnvmelog_C1.binnvmelog_C2.binnvmelog_C4.binnvmelog_C5.binnvmelog_D0.binnvmelog_E6.binnvmelog_E7.binlog typepackagedata_areatelemetry log: 0x%XOSSYSTEM INFORMATIONuname -a >> %slsmod >> %scat /proc/meminfo >> %sSYSTEM INTERRUPT INFORMATIONcat /proc/interrupts >> %sCPU INFORMATIONcat /proc/cpuinfo >> %sIO MEMORY MAP INFORMATIONcat /proc/iomem >> %sMAJOR NUMBER AND DEVICE GROUPcat /proc/devices >> %sKERNEL DMESGdmesg >> %sos_config.txttimestamp_info.txtFailed to send "%s" drive-info.txtFailed to create %s Device NameFW-RevSerial NoModel NoVendorId%-22s : %04X %-22s : %04X DeviceIdsmart logsmart_data.binerror_information_log.binself test logdrive_self_test.binfirmware logeffects logcommand_effects_log.binpersistent event logpersistent_event_log.binnvmetelemetrylog.binnvme_feature_setting_pm.binfeature: 0x%Xnvmelog_FB.binnvmelog_F7.binnvmelog_F8.binnvmelog_F9.binnvmelog_FC.binnvmelog_FD.binnvmelog_CA.binnvmelog_FA.binnvmelog_F6.binnvmelog_FE.binnvmelog_FF.binchanged_namespace_log.binnvmelog_E1.binnvmelog_E2.binnvmelog_E3.binnvmelog_E4.binnvmelog_E5.binnvmelog_E8.binnvmelog_E9.binnvmelog_EA.binfailed to get log: 0x%X log 0x%x.tgztar -zcf "%s" "%s"rm -f -R "%s" >temp.txt 2>&1rm -f temp.txtnot indicatedunselectedPhysical Media Units WrittenPhysical Media Units ReadRaw Bad User NAND Block CountXOR Recovery CountSoft ECC Error CountSystem data % life-usedRefresh CountMaximum User Data Erase CountMinimum User Data Erase CountThermal Throttling CountThermal Throttling StatusPCIe Correctable Error countIncomplete Shutdowns% Free BlocksCapacitor HealthUnaligned I/OSecurity Version NumberPLP Start CountEndurance EstimateLog Page VersionLog Page GUID000b001b010b011bGrown Bad Block CountPer Block Max Erase CountPower On MinutesWrite Protect ReasonDrive CapacityTotal Erase CountLifetime Use RateReported UC ErrorsTotal Bytes ReadTotal Bytes WrittenTU SizeTotal Block Stripe CountFree Block Stripe CountBlock Stripe SizeUser Block Min Erase CountUser Block Avg Erase CountUser Block Max Erase CountNormalized Program Fail CountRaw Program Fail CountNormalized Erase Fail CountRaw Erase Fail CountPcie Correctable Error Count% Free Blocks (User)% Free Blocks (System)Incomplete TRIM Data% Age of Completed TRIMREAD CMDs exceeding thresholdNAND Writes (Bytes Written)Program Failure CountNSZE Change SupportedNumber of NSZE Modifications100us150us200us300us400us500us600us700us800us900us1ms5ms10ms20ms50ms100ms200ms300ms400ms500ms600ms700ms800ms900ms1s2s3s5s8sINFnvme-cli Micron cloud SSD plugin version: %s.%s nvme-cli Micron plugin version: %s.%s.%s Major Version: %u, Minor Version: %u Latency Statistics Log for NVMe device: %s Bucket 1-32 IO Read Command Data-------------------------------------------Bucket 1-32 IO Write Command DataBucket 1-32 IO Trim Command DataMajor Version %u, Minor Version %u: Not supported yet Major Version %u: Not supported yet High Latency Log for NVMe device: %s %-24s%-12s%-12s%-6s%-6s%-6s%-6s%-12s%-24s%-6s%-6s%-6s%-6s%-6s [1-24] hours: duration of the log to be printed, default is 1 hourduration must be between 1 and 24. Performance Stat log for NVMe device: %s %-8s%-14s%-21s%-22s%-22s%-15s%-22s%-23s%-23s %-8u%-14u%-21u%-22u%-22u%-15u%-22u%-23u%-23u %-8s%-23s%-23s%-23s%-23s%-23s%-23s%-23s%-23s %-8u%-23u%-23u%-23u%-23u%-23u%-23u%-23u%-23u Failed to write %s data to %s Failed to open %s file to write %s FW Select (e.g., --select=ALL)This performs a selective firmware download, which allows the user to select which firmware binary to update for 9200 devices. This requires a power cycle once the update completes. The options available are: OOB - This updates the OOB and main firmware EEP - This updates the eeprom and main firmware ALL - This updates the eeprom, OOB, and main firmwareUpdate successful! Power cycle for changes to take effect Retrieve Firmware Activation history of the given driveonly normal format is supported currently Unsupported drive model for vs-fw-activate-history command Failed to retrieve fw activation history log, error: %x Unsupported fw activation history page: %x, version: %x No entries were found in fw activation history log __________________________________________________________________________________ | | | | | | |Firmware | Power On | Power | Previous | New FW | Slot | Commit | ResultActivation| Hour | cycle | firmware | activated | number | Action |Counter | | count | | | | Type |__________|___________|_________|__________|___________|________|________|________Display Latency tracking log informationUnable to retrieve latency stats log the driveTimestamp, Latency, CmdTag, Opcode, Fuse, Psdt, Cid, Nsid, Slba_L, Slba_H, Nlb, %lu,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u Supported log page list Log ID : Description1 - hottest component temperature, 0 - composite temperature (default) for enable option, 0 (current), 1 (default), 2 (saved) for status options1 - persistent, 0 - non-persistent (default)Enable/Disable/Get status of SMBUS option on controllerThis option is not supported for specified drivesuccessfully enabled SMBus on driveFailed to enabled SMBus on driveSMBus status on the drive: %s (returns %s temperature) Failed to retrieve SMBus status on the driveSuccessfully disabled SMBus on driveFailed to disable SMBus on driveInvalid option %s, valid values are enable, disable or status enable or disable or status, default is statuscommands to monitor for - all|read|write|trim, default is all i.e, enabled for all commandsThe threshold value to use for latency monitoring in milliseconds, default is 800msEnable, Disable or Get cmd latency monitoring statsInvalid control option %s specified Failed to retrieve latency monitoring feature statusLatency Tracking Statistics is currently %sThe maximum threshold value cannot be more than 2550 msThe threshold value should be multiple of 10 msInvalid command %s specified for option %s Successfully %sd latency monitoring for %s commands with %dms threshold Failed to %s latency monitoring for %s commands with %dms threshold Failed to clear fw activation history, error = 0x%x Retrieve Micron temperature info for the given device Micron temperature informationMicron temperature information:Clear PCIe Device Correctable ErrorsDevice correctable errors are cleared!Device correctable error counters are cleared!setpci -s %x:%x.%x ECAP_AER+0x10.L=0xffffffffsetpci -s %x:%x.%x ECAP_AER+0x10.LFailed to retrieve error countDevice correctable errors cleared!Device correctable errors detected: %s Extended Smart Log Page : 0xFBERROR : Unsupported drive for vs-drive-info cmdERROR : drive-info opcode failed with 0x%x ERROR : identify_ctrl() failed with 0x%x Drive Hardware Version: %u.%u Retrieve Smart or Extended Smart Health log for the given device Unable to retrieve smart log 0xFB for the driveUnsupported drive model for vs-smart-add-log commandOCP SMART Cloud Health Log: 0xC0Unable to retrieve extended smart log 0xC0 for the driveselect/save values: enable/disable options1 - save (persistent), 0 - non-persistent and for status options: 0 - current, 1 - default, 2-savedEnable or Disable Controller telemetry log generationdrive doesn't support host/controller generated telemetry logssuccessfully set controller telemetry optionFailed to set controller telemetry optionsuccessfully disabled controller telemetry optionFailed to disable controller telemetry optionController telemetry option : %s Failed to retrieve controller telemetry optioninvalid option %s, valid values are enable,disable or status Failed to get telemetry log header for 0x%X Requested telemetry data for 0x%X is empty Failed to get telemetry data for 0x%x command to display stats - all|read|write|trimdefault is alldisplay command latency statisticsInvalid command option %s to display latency stats Micron IO %s Command Latency Statistics Major Revision : %d Minor Revision : %d =============================================Bucket Start End Command CountUnable to fetch ONTAP vserver name Unable to fetch ONTAP volume name Unable to fetch ONTAP namespace name show NBFT discovery controllersDisplay contents of the ACPI NBFT files.%-3.3s|%-*.*s|%-4.4s|%-*.*s|%-5.5s|%-*.*s %-.3s+%-.*s+%-.4s+%-.*s+%-.5s+%-.*s %-3d|%-*.*s|%-4.4s|%-*.*s|%-5.5s|%-*.*s %-3.3s|%-4.4s|%-10.10s|%-17.17s|%-4.4s|%-*.*s|%-4.4s|%-*.*s|%-*.*s %-.3s+%-.4s+%-.10s+%-.17s+%-.4s+%-.*s+%-.4s+%-.*s+%-.*s %-3d|%-4.4s|%-10.10s|%-17.17s|%-4.4s|%-*.*s|%-4d|%-*.*s|%-*.*s Output Format: normal|json|columnDisplay information about E-Series volumes.Unrecognized output format: %s Unable to allocate memory for devices Identify Controller failed to %s (%s) Unable to identify namespace for %s (%s) %-16s %-30s %-30s %-4s %-32s %-4s %-12s %-9s %-9s %-9s %-16s %-30s %-30s %-4s %-32s %-4s %-12s %-9s Display information about ONTAP devices.Unable to identify namespace descriptor for %s (%s) Unable to get log page data for %s (%s) %-16s %-25s %-50s %-4s %-38s %-9s %-9s %-9s %-9s --------------------------------------%-16s %-25s %-50s %-4s %-38s %-9s Cannot allocate controller list payload /sys/class/nvme/nvme%d/device/vendor/sys/class/misc/nvme%d/device/vendor/sys/class/nvme/nvme%d/device/device/sys/class/misc/nvme%d/device/deviceUnsupported Request Error Status (URES)Receiver Overflow Status (ROS)Unexpected Completion Status (UCS)Completion Timeout Status (CTS)Flow Control Protocol Error Status (FCPES)Data Link Protocol Error Status (DLPES)Advisory Non-Fatal Error Status (ANFES)Replay Timer Timeout Status (RTS)REPLAY_NUM Rollover Status (RRS)Unsupported drive model for vs-pcie-stats commandsetpci -s %x:%x.%x ECAP_AER+10.Lsetpci -s %x:%x.%x ECAP_AER+0x4.LDevice uncorrectable errors detected: %s Retrieve Micron NAND stats for the given device Error %d retrieving controller identification data Unsupported drive model for vs-nand-stats commandExtended Smart Log Page : 0xD0Unable to retrieve extended smart log for the driveRetrieve extended SMART logs for the given device Unsupported drive model for vs-smart-ext-log commandtelemetry log type - host or controllerLog output data file name (required)telemetry log data area 1, 2 or 3This retrieves the micron debug log packagetelemetry type (host or controller) should be specified i.e. -t=hostdata area must be selected using -d option ie --d=1,2,3data area option is valid only for telemetry option (i.e --type=host|controller)Log data file must be specified. ie -p=logfile.binLog data file must be specified. ie -p=logfile.zip or -p=logfile.tgz|logfile.tar.gzUnsupported drive model for vs-internal-log collectiontelemetry option is not supported for specified drivePreparing log package. This will take a few seconds...nvme_controller_identify_data.binLINUX KERNEL MODULE INFORMATIONLINUX SYSTEM MEMORY INFORMATIONTimestamp (UTC): %a, %d %b %Y %T %z %s ----------------------------------------------- %-20s : /dev/nvme%d %-20s : %s %-20s : %-20s %-20s : %-20s identify_namespace_%d_data.binSetting persistent event log read ctx failed (ignored)! could not alloc buffer for persistent event log page (ignored)! nvme_feature_setting_arbitration.binnvme_feature_setting_lba_range_namespace_1.binnvme_feature_setting_temp_threshold.binnvme_feature_setting_error_recovery.binnvme_feature_setting_volatile_write_cache.binnvme_feature_setting_num_queues.binnvme_feature_setting_interrupt_coalescing.binnvme_feature_setting_interrupt_vec_config.binnvme_feature_setting_write_atomicity.binnvme_feature_setting_async_event_config.binnvme_feature_setting_sw_progress_marker.binFeature 0x%x data not retrieved, error %d (ignored)! pull hdr failed for %u with error: 0x%x invalid log data for LOG: 0x%X, id: 0x%X, size: %u, max: %u, wp: %u, flags: %u, np: %u malloc of %zu bytes failed for log: 0x%X Unsupported log page format version %d of log page : 0x%X Getting size of log page : 0x%X failed with %d (ignored)! zip -r "%s" "%s" >temp.txt 2>&1Failed to create log data package, %s! Failed to remove temporary files!Normalized Bad User NAND Block CountRaw Bad System NAND Block CountNormalized Bad System NAND Block CountUncorrectable Read Error CountSSD End to End Detected CountsSSD End to End Corrected ErrorsPhysical Media Units Written - TLCPhysical Media Units Written - SLCSSD End to End Uncorrected CountsMinimum User Data Erase Count - TLCMaximum User Data Erase Count - TLCAverage User Data Erase Count - TLCMinimum User Data Erase Count - SLCMaximum User Data Erase Count - SLCAverage User Data Erase Count - SLCDataset Management (Deallocate) CommandsBackground Back-Pressure GaugeWRITE CMDs exceeding thresholdTRIMs CMDs exceeding thresholdNAND XOR/RAID Recovery Trigger EventsܹܹJܹJJJJJJJJJJJJJJJJJJJJJJJJJJJJ..---------------------------------------------------------------------------------------------------micron_logpage_dirmicron_internal_logsmicron_telemetry_cntrl_optionmicron_clr_fw_activation_historymicron_ocp_smart_health_logsmicron_latency_stats_infomicron_latency_stats_logsmicron_latency_stats_trackmicron_fw_activation_historymicron_drive_infomicron_smart_ext_logmicron_nand_statsmicron_clear_pcie_correctable_errorsmicron_pcie_statsmicron_temp_statsmicron_smbus_optionmicron_selective_downloadmb_get_performance_statsmb_get_high_latency_logmb_get_latency_stats%s, Array %s, Vol %s, NSID %d, ID %s, Ctrl %c, %%-16s %-30s %-30s %4d %32s %c %-12s %-9s %-9s%s, Array Name %s, Volume Name %s, NSID %d, Volume ID %s, Controller %c, Access %s, Vserver %s, Path %s, NSID %d, UUID %s, %s, %%-16s %-25s %-50s %-4d %-38s %-9s %-9s %-9s %-9sNamespace Path %s, NSID %d, UUID Package Version******************** Drive Info ******************** PCI Info *check if tar and gzip commands acheck if zip command is installeERROR_INFORMATIONVS_OEM2_FW_SECURITYFW_SLOT_INFORMATIONCHANGED_NAMESPACE_LISTDEVICE_SELF_TESTTELEMETRY_HOST_INITIATEDVS_MEDIA_SMART_LOGVS_DEBUG_LOG1VS_SEC_ERROR_LOG_PAGEVS_LIFE_TIME_DRIVE_HISTORYVS_EXTENDED_SMART_INFOVS_LIST_SUPPORTED_LOG_PAGEVS_POWER_MONITOR_LOG_PAGEVS_CRITICAL_EVENT_LOG_PAGEVS_RECENT_DRIVE_HISTORYUNKNOWNVS_OEM2_REVISIONVS_PCIE_ERROR_LOG_PAGEVS_OEM2_WORK_LOADSMART_INFORMATIONSoft ECC error countBad NAND block countPower On HoursPower Fail Event CountDevice Power Cycle CountRaw Read Error CountUn-KnownRefresh countUser data erase fail countSystem area erase fail countIncomplete shutdownsLSB of Flash GB erasedMSB of Flash GB erasedLIFETIME_DEV_SLEEP_EXIT_COUNTLIFETIME_ENTERING_PS4_COUNTLIFETIME_ENTERING_PS3_COUNTRetired block countProgram fail countSystem data % usedUnexpected power loss countWear range deltaPCIE_INTF_DOWNSHIFT_COUNTE2E_CRC_ERROR_COUNTMax lifetime temperatureRAIS_ECC_CORRECT_ERR_COUNTDRIVE_LIFE_PROTECTION_STATUSRemaining SSD lifeFree SpaceLSB of Trim countMSB of Trim countOP percentageMax lifetime SOC temperatureSupercap AttributesDescription%-39s %-19s Super-cap current temperature%-40sSuper-cap maximum temperatureSuper-cap status 0x%016lx%016lx DRAM correctable error countjson_rpc_2_0_verjson_rpc_2_0_ver : %s raid_recover_cntprog_timeout_cnterase_timeout_cntread_timeout_cntread_ecc_cntnon_media_crc_err_cntcompression_path_err_cntout_of_space_flagphysical_usage_ratiogrown_bb/nMajor Revision : %u Minor Revision : %u Bucket %2d: %u Group 4: Range is 1s-2s: Group 5: Range is 2s-4s: Group 6: Range is 4s+:malloc fail, errno %d Invalid Param get-bad-blockBad Block TableMF_BB_COUNT: %u GROWN_BB_COUNT: %u TOTAL_BB_COUNT: %u REMAP_MFBB_COUNT: %u REMAP_GBB_COUNT: %u REMAP_MFBB_TABLE [ 0x%lx ]REMAP_GBB_TABLE [ATOMICUPDATE_PROVISION_CAPACITYhex feature name (required)feature-id required param ScaleFlux-get-featurequery current capacity infosfx-query-capConfirm Y/y, Others cancel: Canceled. Sending operation ... cap size in GBcap-bytecap size in bytedynamic change capacity%dG %luB %lu 4K sfx-change-capIoctl Fail.ScaleFlux clean card successidentify-namespaceInvalid Param ScaleFlux-set-featureevtlog file(required)namespace_idstorage_mediumparseparse result output filefile required param wb+ Dump-evtlog: SuccessrbRESERVEDTOO_MANY_BBLOW_SPACEHIGH_TEMPERATUREHAS_ASSERTHAS_PANIC_DUMPINVALID_FORMAT_CAPACITYMAT_FAILEDFREEZE_DUE_TO_RECOVERY_FAILEDRFS_BROKENMEDIA_ERR_ON_PAGE_INMEDIA_ERR_ON_MPAGE_HEADERCAPACITOR_BROKENRD_ERR_IN_GSD_RECOVERYRD_ERR_ON_PF_RECOVERYMEDIA_ERR_ON_FULL_RECOVERY Parse-evtlog: Success[%d-%-20s : %u C Current PCB TemperatureCurrent SOC TemperatureHighest Temperature%-20s : %d C Max SOC TemperatureSuper-cap Current TemperatureSuper-cap Max TemperatureCurrent PCB temperatureCurrent SOC temperatureHighest temperatureMax SOC temperatureSuperCap Current temperatureSuperCap Max temperaturePCIe Correctable Error Count%-45s : %u Cpl TLP Poisoned Error Count%-45s : %s namespace_sizenamespace size(required)namespace_capnamespace capacity(required)unitsexpand capacitynamespace_cap required param %sn%uCreate ns failed %s: Success, create nsid:%d LogPage-NameLogPage-Id%-15s %-30s supported_log_pageslogpage_idlogpage_name0x%-15X%-15d0x%016lx%016lxExtended-SMART-Attributesattribute_nameattribute_idattribute_valueST1000KN0002Ext-Smart-ValueExt-Smart-Id%-39s %-15s %-19s Health AttributesBad User NAND BlocksBad System NAND BlocksEnd to End Correction CountsSystem Data Used in ParcentRefresh CountsUser Data Erase CountsDSSD Specification Version %d.%d.%d.%d Free Blocks in PercentNVMe Errata VersionUnaligned IOTotal Namespace UtilizationPCIe Link Retraining CountPower State Change Count%d.%d.%d.%dPrevious FW PCC Timestamp Counter Commit ActionNew FW %-4d %-20s %-5ld %-8s %-8s %-2d 0x%02x 0x%02x Seagate FW Activation HistoryPCCPrevious_FWNew_FWCommit_Actionlog_specific%s: Write Failed Block # :%d to %d Device:%s namespace-id:%#x dump-filedump filehexadecimal feature nameshow infos in binary formatshow infos in readable formatinvalid 'select' param:%d ST1000KN0012ST2000KN0002ST2000KN0012ST4000KN0002XP1600HE10002XP1600HE10012XP1600HE30002XP1600HE30012XP1920LE10002XP1920LE10012XP1920LE30002XP1920LE30012XP3200HE10002XP3200HE10012XP3840LE10002XP3840LE10012XP400HE30002XP400HE30012XP400HE30022XP400HE30032XP480LE30002XP480LE30012XP480LE30022XP480LE30032XP800HE10002XP800HE10012XP800HE30002XP800HE30012XP800HE30022XP800HE30032XP960LE10002XP960LE10012XP960LE30002XP960LE30012XP960LE30022XP960LE30032XP256LE30011XP256LE30021XP7680LE80002XP7680LE80003XP15360LE80003XP30720LE80003XP7200-1A2048XP7200-1A4096XP7201-2A2048XP7201-2A4096XP7200-1A8192ST1000HM0021ST1000HM0031ST1000HM0061ST1000HM0071ST1000HM0081ST1200HM0001ST1600HM0031ST1800HM0001ST1800HM0011ST2000HM0011ST2000HM0031ST400HM0061ST400HM0071ST500HM0021ST500HM0031ST500HM0061ST500HM0071ST500HM0081ST800HM0061ST800HM0071ST1600HM0011ST1600KN0001ST1600KN0011ST1920HM0001ST1920KN0001ST1920KN0011ST400HM0021ST400KN0001ST400KN0011ST480HM0001ST480KN0001ST480KN0011ST800HM0021ST800KN0001ST800KN0011ST960HM0001ST960KN0001ST960KN0011XF1441-1AA251024XF1441-1AA252048XF1441-1AA25512XF1441-1AB251024XF1441-1AB252048XF1441-1AB25512XF1441-1BA251024XF1441-1BA252048XF1441-1BA25512XF1441-1BB251024XF1441-1BB252048XF1441-1BB25512ST400HM0031ST400KN0021ST400KN0031ST480HM0011ST480KN0021ST480KN0031ST800HM0031ST800KN0021ST800KN0031ST960HM0011ST960KN0021ST960KN0031XM1441-1AA111024XM1441-1AA112048XM1441-1AA11512XM1441-1AA801024XM1441-1AA80512XM1441-1AB111024XM1441-1AB112048XM1441-1BA111024XM1441-1BA112048XM1441-1BA11512XM1441-1BA801024XM1441-1BA80512XM1441-1BB112048COMMANDS_SUPPORTED_AND_EFFECTSTELEMETRY_CONTROLLER_INITIATEDDRAM Supercap SMART AttributesSSD End to end correction countsThermal throttling status and countPCIe Uncorrectable Error countUncorrectable RAISE error countLSB of Physical (NAND) bytes writtenMSB of Physical (NAND) bytes writtenLSB of Physical (HOST) bytes writtenMSB of Physical (HOST) bytes writtenLSB of Physical (NAND) bytes readMSB of Physical (NAND) bytes read Seagate DRAM Supercap SMART Attributes :Data units read to DRAM namespaceData units written to DRAM namespaceDRAM uncorrectable error countSeagate-Plugin version : %d.%d Seagate-OCP-Plugin version : %d.%d Get ScaleFlux vendor specific additional smart log (optionally, for the specified namespace), and show it.Additional Smart Log for ScaleFlux device:%s namespace-id:%x raid_recover_cnt : %3d%% %lu read_ecc_cnt : %3d%% %lu prog_timeout_cnt : %3d%% %lu erase_timeout_cnt : %3d%% %lu read_timeout_cnt : %3d%% %lu non_media_crc_err_cnt : %3d%% %lu compression_path_err_cnt : %3d%% %lu out_of_space_flag : %3d%% %lu phy_capacity_used_ratio : %3d%% %lu grown_bb_count : %3d%% %lu Get ScaleFlux Latency Statistics log and show it.ScaleFlux IO %s Command Latency Statistics Group 1: Range is 0-1ms, step is 32us Group 2: Range is 1-32ms, step is 1ms Group 3: Range is 32ms-1s, step is 32ms: Group 1: Range is 0us~63us, step 1us Group 2: Range is 63us~127us, step 1us Group 3: Range is 127us~255us, step 2us Group 4: Range is 255us~510us, step 4us Group 5: Range is 510us~1.02ms step Group 6: Range is 1.02ms~2.04ms step 16us Group 7: Range is 2.04ms~4.08ms step 32us Group 8: Range is 4.08ms~8.16ms step 64us Group 9: Range is 8.16ms~16.32ms step 128us Group 10: Range is 16.32ms~32.64ms step 256us Group 11: Range is 32.64ms~65.28ms step 512us Group 12: Range is 65.28ms~130.56ms step 1.024ms Group 13: Range is 130.56ms~261.12ms step 2.048ms Group 14: Range is 261.12ms~522.24ms step 4.096ms Group 15: Range is 522.24ms~1.04s step 8.192ms Group 16: Range is 1.04s~2.09s step 16.384ms Group 17: Range is 2.09s~4.18s step 32.768ms Group 18: Range is 4.18s~8.36s step 65.536ms Group 19: Range is 8.36s~ step 131.072ms Average latency statistics %lu ScaleFlux IO %s Command Latency Statistics Invalid Version Maj %d Min %d Get Shannon vendor specific additional smart log (optionally, for the specified namespace), and show it.key normalized valuethermal_throttle_status : %3d%% CurTTSta: %u%%, TTCnt: %u sram_error_count : %3d%% %lu Get bad block table of sfx block device.ScaleFlux get bad block table: successScaleFlux internal set features feature id 1: ATOMICScaleFlux get-feature:%02x (%s), value:%d logic capacity:%5lluGB(0x%lx) provisioned capacity:%5lluGB(0x%lx) free provisioned capacity:%5lluGB(0x%lx) used provisioned capacity:%5lluGB(0x%lx) map_unit :0x%lxK WARNING: %s. Use the force [--force] option to suppress this warning. change-cap query mem info failWARNING: Free memory is not enough! Please drop cache or extend more memory and retry WARNING: Memory needed is %lu, free memory is %lu ScaleFlux change-capacity: failChanging Cap may irrevocably delete this device's dataScaleFlux change-capacity: successWARNING: Only support 1.0~4.0 x provisioned capacity! WARNING: The target capacity is less than 1.0 x provisioned capacity! WARNING: The target capacity is larger than 4.0 x provisioned capacity! ScaleFlux internal set features feature id 1: ATOMIC value 0: Disable atomic write 1: Enable atomic writeGoing to clean device's data, confirm umount fs and try againError: requesting clean card on non-controller handle Please change-sector size to 4K, then retryChanging physical capacity may irrevocably delete this device's dataScaleFlux set-feature:%#02x (%s), value:%d evtlog storage medium 0: nand(default) 1: norparse error & warning evtlog from evtlog filedump evtlog into file and parseoutput file required if evtlog need be parsed Unable to get evtlog lsp=0x%x, ret = 0x%x Failed to open %s file to write Unable to get evtlog offset=0x%x len 0x%x ret = 0x%x Failed to write evtlog to file Failed to alloc enough memory 0x%x to parse evtlog Failed to open %s file to read Failed to read evtlog to buffer READONLY_DUE_TO_RECOVERY_FAILED > fw_version: %s > bl2_version: %s > error_str: [WARNING][%s] > error_str: [ERROR][%s] > assert_id: %d > error_str: [ERROR][%s] Failed to write parse result to output file Retrieve Seagate Temperature Stats information for the given device Seagate Temperature Stats Information :Retrieve Seagate PCIe error counters for the given device Seagate PCIe error counters Information :PCIe Un-Correctable Error CountUnexpected Completion Status(UCS)Data Link Protocol Error Status(DLPES)Replay Timer Timeout Status(RTS)Replay_NUM Rollover Status(RRS)Cpl TLP Unsupported Request Error CountCpl TLP Completion Abort Error CountRequest Completion Abort Error CountAdvisory Non-Fatal Error Status(ANFES)LBA format to apply 0: 512(default) 1: 4096namespace size/capacity units 0: GB(default) 1: LBAnamespace_id or blk device required namespace_size required param Expand namespace not the last one Retrieve Seagate Supported Log-Page information for the given device Seagate Supported Log-pages count :%d Retrieve the Firmware Activation History for Seagate NVMe drivesSeagate Extended SMART Information : Seagate SMART Health Attributes :Thermal Throttling Status and CountSeagate SMART Health AttributesRetrieve FW Activate History for Seagate device Seagate FW Activation History Information : Seagate FW Activation History :%-9s %-21s %-7s %-13s %-9s %-5s %-15s %-9s Do not have valid FW Activation HistoryClear FW Activation History for the given Seagate device %s: couldn't clear PCIe correctable errors Device does not support Clear FW Activation HistoryClear Seagate PCIe Correctable counters for the given device 1 - controller shall capture Data representing the internal state of the controller at the time the command is processed. 0 - controller shall not update the Telemetry Host Initiated Data.Capture the Telemetry Host-Initiated Data in either hex-dump (default) or binary formatData Block 1 Last Block:%d Data Block 2 Last Block:%d Data Block 3 Last Block:%d could not alloc buffer for log Capture the Telemetry Controller-Initiated Data in either hex-dump (default) or binary formatCapture the Telemetry Controller-Initiated Data in binary format[0-3]: curr./default/saved/supp.buffer len (if) data is returneddword 11 for interrupt vector configRead operating parameters of the specified controller. Operating parameters are grouped and identified by Feature Identifiers; each Feature Identifier contains one or more attributes that may affect behavior of the feature. Each Feature has three possible settings: default, saveable, and current. If a Feature is saveable, it may be modified by set-feature. Default values are vendor-specific and not changeable. Use set-feature to change saveable Features. Available additional feature id: 0x02: Shannon power management PЍ`pЍЎ||L܍̍ЎȎ؎( H@80xphЏȏXP`؏get_additional_featureget_additional_smart_logvs_internal_logget_ctrl_teleseaget_d_rawget_host_televs_clr_pcie_correctable_errsclear_fw_activate_historystx_vs_fw_activate_historyvs_pcie_error_logtemp_statsvs_smart_loglog_pages_suppnvme_expand_capnvme_dump_evtlogsfx_get_featuresfx_set_featurechange_capquery_cap_infosfx_get_bad_blockget_lat_stats_logget_additional_smart_log] event-log: 1.0%s: SCT status failed :%d ] %d %% "bit %u":"%ub %s" %s },%s: couldn't get log 0x%x %s: couldn't output file %s Error Log : %u SMART Health Log : %u Firmware Slot Info : %u Command Effects : %u Device Self Test : %u Log Page Directory : %u SMART Attributes : %u Get nvme health percentage.Transcend NVME heath value: 0%% prev-logGetting previous logGetting current logPage: %u of %zu Page: %zu of %zu %s: bad SCT status %s: couldn't get fw log Get nvme bad block number."Power State Descriptors":{ "ACTP":"Active Power," "MP":"Maximum Power," "IDLP":"Idle Power," "Ofs":"BYTE Offset,"MPSNOPS0fs 00-03ACTPAPWAPS0fs 20-23IDLPIPS0fs 16-19RRTRRLRWTRWL0fs 12-15EXLATENLAT=========%6d%9sh%4ub%3ub%5sh%3sh%3sb%u%u%u%4sb "} }HMAC SHA-2561 = supports reservations00b = SGLs are not supported11b = Reserved "PCI Vendor ID":"%sh", "Serial Number":"%s", "Model Number":"%s", "Value":"%sh", "Controller ID":"%sh", "Version":"%sh", "Controller Attributes":{ "Firmware Updates":{ "Log Page Attributes":{ "Total Size":"%u", "Access Size":"%u", "Sanitize Capabilities":{ "Maximum Size":"%u", } "Format NVM Attributes":{ "Volatile Write Cache":{ "SGL Support":{ "bit 1:0":"%s", } {"Vendor Specific":"[%08X] %02X [%08lX] "}Cannot read namespace-idCannot read device SMART logCannot malloc bufferlog;%s;%lu;%s;%s;%-.*s;Capacity;%lf;Critical_Warning;%u;Temperature;%u;Available_Spare;%u;Available_Spare_Threshold;%u;Percentage_Used;%u;Data_Units_Read;%s;Data_Units_Written;%s;Host_Read_Commands;%s;Host_Write_Commands;%s;Controller_Busy_Time;%s;Power_Cycles;%s;Power_On_Hours;%s;Unsafe_Shutdowns;%s;Media_Errors;%s;Num_Err_Log_Entries;%s;Warning_Temperature_Time;%u;Temperature_Sensor_%d;NC;Temperature_Sensor_%d;%d;NandWrites;%d; Cannot open %s Cannot read identify devicefilename too longtest name too longLog file: %s run-timetest-nameNAME%Y-%m-%dFilename too longRunning...Running for %lf hour(s) Cannot update driver log%s: ERROR: WDC: %s: ERROR: WDC:ERROR: WDC: malloc: %s ERROR: WDC: calloc: %s %s/device/vendorUnable to find %s %s/device/device/vendor%s/device/device/device%s%.*s%sERROR: WDC: open: %s ERROR: WDC: write: %s ERROR: WDC: fsync: %s %s: ERROR: malloc: %s _crash_dump_pfail_dumpOutput file pathname.transfer-sizeData retrieval transfer size.Capture Diagnostics Log.cap_diagfile-sizeDisplay more debug messages.Internal Firmware Log.ERROR: WDC: Invalid length %02u%02u%02u_%02u%02u%02u_internal_fw_log_%s%s: filename = %s NONEHOSTCONTROLLER%s: filename = %s.tar.gz %s.tar.gzFile path is too long! Output file already exists! Creating temp directory...Failed to create directory! NVMe Telemetry log...%s/telemetry.binget-telemetry-logvs-internal-logArchiving...tar --remove-files -czf %s %sCommand buffer is too long! full_log%s%s%s_%s.binkey_logcore_dump_logextended_log*.bintar -czf%s %s %sCapture Drive Log.drive_logGet Crash Dump.Get Pfail Crash Dump.buffer length if data requiredModify the saveable or changeable current operating parameters of the controller. Operating parameters are grouped and identified by Feature Identifiers. Feature settings can be applied to the entire controller and all associated namespaces, or to only a few namespace(s) associated with the controller. Default values for each Feature are vendor-specific and may not be modified. Use get-feature to determine which Features are supported by the controller and are saveable/changeable. Available additional feature id: 0x02: Shannon power management failed to read data buffer from input file can not allocate feature payload OCP Clear Firmware Update HistoryOCP Clear PCIe Correctable Error CountersPrints OCP extensions version of Solidigm plugin%s: unexpected value in SCT status[0]:(%x) %s: command unsupported on this device: (0x%x) Clear PCIe correctable error count.%s: failed to parse arguments (optional) binary output filename(optional) log ID (0xC0, or 0xCA), default 0xCAGet extended SMART information and show it.%s: invalid log page 0x%x - should be 0xC0 or 0xCA Vendor Log Page Directory 0xC0 for NVME device:%s namespace-id:%x %s: couldn't get vendor log 0x%x %s: couldn't write all data to output file %s (optional) use previous log. Otherwise uses current log.Get internal status log and show it.%s: SCT command transfer failed %s: SCT data transfer failed, page 0 %s: SCT data transfer command failed %s: couldn't write all data to output file Transcend NVME badblock count: %d ERROR: WDC: reading DUI data failed ERROR: WDC: reading DUI data V2 failed "NOPS":"Non-Operational State," "MPS":"Max Power Scale (0: in 0.01 Watts; 1: in 0.0001 Watts)," "ENLAT":"Entry Latency in microseconds," "RWL":"Relative Write Latency," "RRL":"Relative Read Latency," "IPS":"Idle Power Scale (00b: Not reported; 01b: 0.0001 W; 10b: 0.01 W; 11b: Reserved)," "APS":"Active Power Scale (00b: Not reported; 01b: 0.0001 W; 10b: 0.01 W; 11b: Reserved)," "EXLAT":"Exit Latency in microsecond," "RWT":"Relative Write Throughput," "RRT":"Relative Read Throughput," "APW":"Active Power Workload," "Power State Descriptors":"%6s%10s%5s%4s%6s%10s%10s%10s%4s%4s%4s%4s%10s%4s%6s%10s%4s%5s%6s 0 = does not support the Security Send and Security Receive commands1 = supports the Security Send and Security Receive commands0 = does not support the Format NVM command1 = supports the Format NVM command0 = does not support the Firmware Commit and Firmware Image Download commands1 = supports the Firmware Commit and Firmware Image Download commands0 = does not support the Namespace Management capability1 = supports the Namespace Management capability0 = does not support the Device Self-test command1 = supports the Device Self-test command0 = does not support Directives1 = supports Directive Send & Directive Receive commands0 = does not support the NVMe-MI Send and NVMe-MI Receive commands1 = supports the NVMe-MI Send and NVMe-MI Receive commands0 = does not support the Virtualization Management command1 = supports the Virtualization Management command0 = does not support the Doorbell Buffer Config command1 = supports the Doorbell Buffer Config command0 = does not support the SMART / Health information log page on a per namespace basis1 = supports the SMART / Health information log page on a per namespace basis0 = does not support the Commands Supported & Effects log page1 = supports the Commands Supported Effects log page0 = does not support extended data for Get Log Page1 = supports extended data for Get Log Page (including extended Number of Dwords and Log Page Offset fields)0 = does not support the Telemetry Host-Initiated and Telemetry Controller-Initiated log pages and Telemetry Log Notices events1 = supports the Telemetry Host-Initiated and Telemetry Controller-Initiated log pages and sending Telemetry Log Notices0 = does not support the Compare command1 = supports the Compare command0 = does not support the Write Uncorrectable command1 = supports the Write Uncorrectable command0 = does not support the Dataset Management command1 = supports the Dataset Management command0 = does not support the Write Zeroes command1 = supports the Write Zeroes command0 = does not support the Save field set to a non-zero value in the Set Features and the Get Features commands1 = supports the Save field set to a non-zero value in the Set Features and the Get Features commands0 = does not support reservations0 = does not support the Timestamp feature (refer to section 5.21.1.14)1 = supports the Timestamp feature01b = SGLs are supported. There is no alignment nor granularity requirement for Data Blocks10b = SGLs are supported. There is a Dword alignment and granularity requirement for Data Blocks "PCI Subsystem Vendor ID":"%sh", "Firmware Revision":"%-.*s", "Recommended Arbitration Burst":"%sh", "IEEE OUI Identifier":"%sh", "Controller Multi-Path I/O and Namespace Sharing Capabilities":{0 = the NVM subsystem contains only a single NVM subsystem port1 = the NVM subsystem may contain more than one subsystem ports0 = the NVM subsystem contains only a single controller1 = the NVM subsystem may contain two or more controllers (see section 1.4.1)0 = the controller is associated with a PCI Function or a Fabrics connection1 = the controller is associated with an SR-IOV Virtual Function "Maximum Data Transfer Size":"%sh", "RTD3 Resume Latency":"%sh", "RTD3 Entry Latency":"%sh", "Optional Asynchronous Events Supported":{0 = does not support sending the Namespace Attribute Notices event nor the associated Changed Namespace List log page1 = supports sending the Namespace Attribute Notices & the associated Changed Namespace List log page0 = does not support sending Firmware Activation Notices event1 = supports sending Firmware Activation Notices0 = does not support a 128-bit Host Identifier1 = supports a 128-bit Host Identifier0 = does not support Non-Operational Power State Permissive Mode1 = supports Non-Operational Power State Permissive Mode "FRU Globally Unique Identifier":"%sh", "NVMe Management Interface Specification":"%sh", "Optional Admin Command Support":{ "Abort Command Limit":"%sh", "Asynchronous Event Request Limit":"%sh", 0 = the 1st firmware slot (slot 1) is read/write1 = the 1st firmware slot (slot 1) is read only "Firmware Slot":"%uh", 0 = requires a reset for firmware to be activated1 = supports firmware activation without a reset "Error Log Page Entries":"%sh", "Number of Power States Support":"%sh", "Admin Vendor Specific Command Configuration":{0 = the format of all Admin Vendor Specific Commands are vendor specific1 = all Admin Vendor Specific Commands use the format defined in NVM Express specification "Autonomous Power State Transition Attributes":{0 = does not support autonomous power state transitions1 = supports autonomous power state transitions "Warning Composite Temperature Threshold":"%sh", "Critical Composite Temperature Threshold":"%sh", "Maximum Time for Firmware Activation":"%sh", "Host Memory Buffer Preferred Size":"%sh", "Host Memory Buffer Minimum Size":"%sh", "Total NVM Capacity":"%sh", "Unallocated NVM Capacity":"%sh", "Replay Protected Memory Block Support":{ "Number of RPMB Units":"%u", "Authentication Method":"%u: %s", "Extended Device Self-test Time":"%sh", "Device Self-test Options":{0 = the NVM subsystem supports one device self-test operation per controller at a time1 = the NVM subsystem supports only one device self-test operation in progress at a time "Firmware Update Granularity":"%sh", "Keep Alive Support":"%sh", "Host Controlled Thermal Management Attributes":{0 = does not support host controlled thermal management1 = supports host controlled thermal management. Supports Set Features & Get Features commands with the Feature Identifier field set to 10h "Minimum Thermal Management Temperature":"%sh", "Maximum Thermal Management Temperature":"%sh", 0 = does not support the Crypto Erase sanitize operation1 = supports the Crypto Erase sanitize operation0 = does not support the Block Erase sanitize operation1 = supports the Block Erase sanitize operation0 = does not support the Overwrite sanitize operation1 = supports the Overwrite sanitize operation "Submission Queue Entry Size":{ "Required Size":"%u", "Completion Queue Entry Size":{ "Maximum Outstanding Commands":"%sh", "Number of Namespaces":"%sh", "Optional NVM Command Support":{ "Fused Operation Support":{0 = does not support the Compare and Write fused operation1 = supports the Compare and Write fused operation0 = supports format on a per namespace basis1 = all namespaces shall be configured with the same attributes and a format (excluding secure erase) of any namespace results in a format of all namespaces in an NVM subsystem0 = any secure erase performed as part of a format results in a secure erase of a particular namespace specified1 = any secure erase performed as part of a format operation results in a secure erase of all namespaces in the NVM subsystem0 = cryptographic erase is not supported1 = cryptographic erase is supported as part of the secure erase functionality0 = a volatile write cache is not present1 = a volatile write cache is present "Atomic Write Unit Normal":"%sh", "Atomic Write Unit Power Fail":"%sh", "NVM Vendor Specific Command Configuration":{0 = the format of all NVM Vendor Specific Commands are vendor specific1 = all NVM Vendor Specific Commands use the format defined in NVM Express specification "Atomic Compare 0 Write Unit":"%sh", "NVM Subsystem NVMe Qualified Name":"%s", 0 = does not support the Keyed SGL Data Block descriptor1 = supports the Keyed SGL Data Block descriptor0 = the SGL Bit Bucket descriptor is not supported1 = the SGL Bit Bucket descriptor is supported0 = use of a byte aligned contiguous physical buffer of metadata is not supported1 = use of a byte aligned contiguous physical buffer of metadata is supported0 = the SGL length shall be equal to the amount of data to be transferred1 = supports commands that contain a data or metadata SGL of a length larger than the amount of data to be transferred0 = use of Metadata Pointer (MPTR) that contains an address of an SGL segment containing exactly one SGL Descriptor that is Qword aligned is not supported1 = use of Metadata Pointer (MPTR) that contains an address of an SGL segment containing exactly one SGL Descriptor that is Qword aligned is supported0 = the Address field specifying an offset is not supported1 = supports the Address field in SGL Data Block, SGL Segment, and SGL Last Segment descriptor types specifying an offsetCannot read namespace identifyCannot read device identify controllerCritical_Composite_Temperature_Time;%u;Thermal_Management_T1_Trans_Count;%u;Thermal_Management_T2_Trans_Count;%u;Thermal_Management_T1_Total_Time;%u;Thermal_Management_T2_Total_Time;%u;Parse identify data to json format Typical usages: virtium show-identify /dev/yourDevice Error parse and open (err = %d) ERROR: WDC: nvme_identify_ctrl() failed 0x%x Cannot read device firmware logheader;{"session":{"testName":"%s","dateTime":"%s"},"devices":[{"model":"%s","port":"%s","SN":"%s","type":"NVMe","identify":"%s","firmwareSlot":"%s"}]} (optional) Number of hours to log data (default = 20 hours)(optional) How often you want to log SMART data (0.25 = 15' , 0.5 = 30' , 1 = 1 hour, 2 = 2 hours, etc.). Default = 10 hours.(optional) Name of the log file (give it a name that easy for you to remember what the test is). You can leave it blank too, we will take care it for you.(optional) Name of the test you are doing. We use this as part of the name of the log file.Save SMART data into log file with format that is easy to analyze (comma delimited). Maximum log file will be 4K. Typical usages: Temperature characterization: virtium save-smart-to-vtview-log /dev/yourDevice --run-time=100 --record-frequency=0.25 --test-name=burn-in-at-(-40) Endurance testing : virtium save-smart-to-vtview-log /dev/yourDevice --run-time=100 --record-frequency=1 --test-name=Endurance-test-JEDEG-219-workload Just logging : virtium save-smart-to-vtview-log /dev/yourDeviceCollecting data for device %s Logging SMART data for every %lf hour(s) %s: ERROR: log header malloc failed : status %s, size 0x%x %s: ERROR: WDC: Get DUI headers failed INFO: WDC: Capture V1 Device Unit Info log, data area = %d INFO: WDC: DUI Header Version = 0x%x INFO: WDC: DUI section count = 0x%x INFO: WDC: DUI log size = 0x%x INFO: WDC: Capture V1 Device Unit Info log is empty %s: section size 0x%x, total size = 0x%x %s: ERROR: dump data V1 malloc failed : status %s, size = 0x%x %s: Failed to open output file %s: %s! %s: Failed to flush header data to file! %s: ERROR: WDC: Get chunk %d, size = 0x%lx, offset = 0x%x, addr = %p %s: ERROR: WDC: Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size = 0x%x INFO: WDC: Capture V2 or V3 Device Unit Info log, data area = %d INFO: WDC: DUI Product ID = 0x%x/%c INFO: WDC: Capture V2 or V3 Device Unit Info log is empty %s: Data area ID %d : section size 0x%x, total size = 0x%lx %s: break, total size = 0x%lx %s: INFO: WDC: Offset 0x%lx exceeds total size 0x%lx, no data retrieved %s: ERROR: dump data v3 malloc failed : status %s, size = 0x%lx %s: INFO: WDC: Offset 0x%lx, file size 0x%lx, total size 0x%lx, log size 0x%lx %s: ERROR: WDC: Get chunk %d, size = 0x%lx, offset = 0x%lx, addr = %p %s: ERROR: WDC: Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size = 0x%lx INFO: WDC: Capture V4 Device Unit Info log, data area = %d INFO: WDC: DUI log size sectors = 0x%x INFO: WDC: DUI cap_dui_length = 0x%lx INFO: WDC: Capture V4 Device Unit Info log is empty %s: Data area ID %d : section size 0x%x sectors, section size 0x%lx bytes, total size = 0x%lx %s: ERROR: dump data V4 malloc failed : status %s, size = 0x%x %s: ERROR: WDC: Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size_long = 0x%lx INFO: WDC: Unsupported header version = 0x%x INFO: WDC: Capture Device Unit Info log, length = 0x%lx ERROR: WDC: %s : Open vendor file failed %s: Read of pci vendor id failed ERROR: WDC: %s : Open device file failed %s: Read of pci device id failed ERROR: WDC: unsupported WDC device, Vendor ID = 0x%x, Device ID = 0x%x ERROR: WDC: cannot format serial number due to data of unexpected length ERROR: WDC: invalid log file length ERROR: WDC: failed to generate file name INFO: WDC: Pfail dump get size failed INFO: WDC: Crash dump get size failed INFO: WDC: Pfail dump is empty INFO: WDC: Crash dump is empty %s: ERROR: WDC: Get chunk %d, size = 0x%x, offset = 0x%x, addr = 0x%lx ERROR: WDC: Crash dump erase failed ERROR: WDC: cbs_data ptr = NULL ERROR: WDC: 0xC2 Log Page entry ID 0x%x not found %s: ERROR: WDC: invalid customer id ERROR: WDC: file name overflow ERROR: WDC: unsupported device for this command Data area to retrieve up to. Currently only supported on the SN340, SN640, SN730, and SN840 devices.Output file size. Currently only supported on the SN340 device.Output file data offset. Currently only supported on the SN340 device.Telemetry type - NONE, HOST, or CONTROLLER. Currently only supported on the SN530, SN640, SN730, SN740, SN810, SN840 and ZN350 devices.ERROR: WDC: Data area must be 1-5 ERROR: WDC: Invalid type - Must be NONE, HOST or CONTROLLER Failed to allocate %zu bytes for log: %s Failed to open output file %s: %s! Failed to acquire telemetry header %d! Failed to acquire full telemetry log! Failed to create an archive file! Stored log files in directory: %s ERROR: WDC: get current working directory failed ERROR: WDC: create directory failed, ret = %d, dir = %s ERROR: WDC: Tar of log data failed, ret = %d ERROR: WDC: failed to read crash dump ERROR: WDC: failed to read pfail crash dump wdc_do_drive_logwdc_do_dumpwdc_do_clear_dumpwdc_do_crash_dumpdump_internal_logswdc_vs_internal_fw_logwdc_do_cap_dui_v1wdc_do_cap_dui_v2_v3wdc_do_cap_dui_v4wdc_do_cap_duiwdc_get_serial_namewdc_get_enc_drive_capabilitieswdc_get_drive_capabilitieswdc_get_model_numberwdc_get_vendor_idwdc_get_pci_idsvt_show_identifyvt_save_smart_to_vtview_loggetBadblockgetHealthValueclear_correctable_errorsnvme_get_internal_loginternal_lognvme_get_vendor_logvendor_lognvme_get_sct_statusset_additional_featureB_eA4@$@ @0123456789ABCDEFPut the name of ./vtView-Smart-l CA Log Page Performance Statistics :- NAND Bytes Written %20lu%20lu NAND Bytes Read %20lu%20lu NAND Bad Block Count (Normalized) %20lu NAND Bad Block Count (Raw) %20lu Uncorrectable Read Count %20lu Soft ECC Error Count %20lu SSD End to End Detected Correction Count %20u SSD End to End Corrected Correction Count %20u System Data Percent Used %20u%% User Data Erase Counts Max %20u User Data Erase Counts Min %20u Refresh Count %20lu Program Fail Count (Normalized) %20lu Program Fail Count (Raw) %20lu User Data Erase Fail Count (Normalized) %20lu User Data Erase Fail Count (Raw) %20lu System Area Erase Fail Count (Normalized) %20lu System Area Erase Fail Count (Raw) %20lu Thermal Throttling Status %20u Thermal Throttling Count %20u PCIe Correctable Error Count %20lu Incomplete Shutdown Count %20u Percent Free Blocks %20u%% ERROR: WDC: Cannot execute purge, Purge operation is in progress. ERROR: WDC: Internal Device Error. Purge Operation resulted in an error that requires power cycle.The previous purge operation was interrupted by a power cycle or reset interruption. Other commands may be rejected until Purge Execute is issued and completed.NAND Bad Block Count (Normalized)SSD End to End Detected Correction CountSSD End to End Corrected Correction CountProgram Fail Count (Normalized)User Data Erase Fail Count (Normalized)User Data Erase Fail Count (Raw)System Area Erase Fail Count (Normalized)System Area Erase Fail Count (Raw) End of Life Log Page 0xC0 :-ERROR: WDC: Unable to read C0 Log Page data Retrieve Hardware Revision Log InformationERROR: WDC %s: invalid output format ERROR: WDC: Invalid buffer to read Hardware Revision log Global Device HW Revision : %d PCB Manufacturer Code : %d DRAM Manufacturer Code : %d NAND Manufacturer Code : %d PMIC 1 Manufacturer Code : %d PMIC 2 Manufacturer Code : %d Other Component 1 Manf Code : %d Other Component 2 Manf Code : %d Other Component 3 Manf Code : %d Other Component 4 Manf Code : %d Other Component 5 Manf Code : %d Other Component 6 Manf Code : %d Other Component 7 Manf Code : %d Other Component 8 Manf Code : %d Other Component 9 Manf Code : %d Device Manf Detailed Info : 0x Component 1 Detailed Info : 0x Component 2 Detailed Info : 0x Component 3 Detailed Info : 0x Component 4 Detailed Info : 0x Component 5 Detailed Info : 0x Component 6 Detailed Info : 0x Component 7 Detailed Info : 0x Component 8 Detailed Info : 0x Component 9 Detailed Info : 0xERROR: WDC: Unable to read Hardware Revision Log Page data Retrieve error recovery log data.ERROR: WDC: invalid output format ERROR: WDC: invalid error recovery log version - %d ERROR: WDC: Unknown GUID in C1 Log Page data ERROR: WDC: Expected GUID: 0x ERROR: WDC: Actual GUID: 0xError Recovery/C1 Log Page Data Panic Reset Wait Time : 0x%x Panic Reset Action : 0x%x Device Recovery Action 1 : 0x%x Panic ID : 0x%lu Device Capabilities : 0x%x Vendor Specific Recovery Opcode : 0x%x Vendor Specific Command CDW12 : 0x%x Vendor Specific Command CDW13 : 0x%x Vendor Specific Command Timeout : 0x%x Device Recovery Action 2 : 0x%x Device Recovery Action 2 Timeout : 0x%x Panic Count : 0x%x Previous Panic ID N-%d : 0x%lx Log Page Version : 0x%x Log page GUID : 0xVendor Specific Recovery OpcodeVendor Specific Command TimeoutDevice Recovery Action 2 TimeoutERROR: WDC: Unable to read error recovery (C1) data from buffer ERROR: WDC: Failure reading the Error Recovery (C1) Log Page, ret = 0x%x Retrieve device capabilities log data.ERROR: WDC: invalid device capabilities log version - %d ERROR: WDC: Unknown GUID in C4 Log Page data Device Capabilities/C4 Log Page Data Number OOB Management Interfaces : 0x%x Write Zeros Command Support : 0x%x Sanitize Command Support : 0x%x DSM Command Support : 0x%x Write Uncorr Command Support : 0x%x Fused Command Support : 0x%x Minimum DSSD Power State : 0x%x DSSD Power State %d Descriptor : 0x%x Number OOB Management InterfacesDSSD Power State %d DescriptorERROR: WDC: Unable to read device capabilities (C4) data from buffer ERROR: WDC: Failure reading the Device Capabilities (C4) Log Page, ret = 0x%x Retrieve unsupported requirements log data.ERROR: WDC: invalid unsupported requirements log version - %d ERROR: WDC: Unknown GUID in C5 Log Page data Unsupported Requirements/C5 Log Page Data Number Unsupported Req IDs : 0x%x Unsupported Requirement List %d : %s Unsupported Requirement List %dERROR: WDC: Unable to read unsupported requirements (C5) data from buffer ERROR: WDC: Failure reading the Unsupported Requirements (C5) Log Page, ret = 0x%x Retrieve latency monitor log data.ERROR: WDC: invalid latency monitor version ERROR: WDC: Unknown GUID in C3 Log Page data Active Lantency Minimum WindowActive Bucket Counter: Bucket %d %sActive Measured Latency: Bucket %d %sActive Latency Time Stamp: Bucket %d %sStatic Bucket Counter: Bucket %d %sStatic Measured Latency: Bucket %d %sStatic Latency Time Stamp: Bucket %d %sERROR: WDC: Unable to read C3 data from buffer ERROR: WDC: Failure reading the Latency Monitor (C3) Log Page, ret = %d Clear FW activate history table.ERROR: WDC: 0xC2 Log Page not supported ERROR: WDC: Get Assert Status Failed ERROR: WDC: Get Thermal Throttling Status Failed ERROR: WDC: Get User EOL Status Failed ERROR: WDC: Get User EOL State Failed ERROR: WDC: Get System EOL State Failed ERROR: WDC: Get Format Corrupt Reason Failed Drive Life Status: End Of Life Drive Life Status: Read Only Drive Life Status: Unknown : 0x%08x/0x%08x Assert Dump Status: Present Assert Dump Status: Not Present Assert Dump Status: Unknown : 0x%08x Thermal Throttling Status: Off Thermal Throttling Status: On Thermal Throttling Status: Unavailable Thermal Throttling Status: Unknown : 0x%08x Format Corrupt Reason: Format Not Corrupted Format Corrupt Reason: Format Corrupt due to FW Assert Format Corrupt Reason: Format Corrupt for Unknown Reason Format Corrupt Reason: Unknown : 0x%08x Clear PCIE Correctable Errors.Clear Assert Dump Present Status.INFO: WDC: No Assert Dump Present Disable controller option of the telemetry log page.Enable controller option of the telemetry log page.Displays the current state of the controller initiated log page.Disable/Enable Controller Option of the Telemetry Log Page.Controller Option Telemetry Log Page State: Disabled Controller Option Telemetry Log Page State: Enabled ERROR: WDC: unsupported option for this command Please provide an option, -d, -e or -s ERROR: WDC: Unknown GUID in C0 Log Page V1 data Retrieve Cloud Log Smart/Health InformationERROR: WDC: Unable to read C0 Log Page V1 data Retrieve Device Write Amplication FactorERROR: WDC %s: get smart cloud log failure ERROR: WDC %s: 0 data units written Device Write Amplification Factor TLC : %4.2Lf Device Write Amplification Factor SLC : %4.2Lf Device Write Amplification Factor TLCDevice Write Amplification Factor SLC Physical Media Units Written TLC (Bytes): %s Physical Media Units Written SLC (Bytes): %s Bad User NAND Block Count (Normalized) (Int) : %d Bad User NAND Block Count (Raw) (Int) : %lu XOR Recovery Count (Int) : %lu Uncorrectable Read Error Count (Int) : %lu SSD End to End correction counts (Corrected Errors) (Int) : %lu SSD End to End correction counts (Detected Errors) (Int) : %lu SSD End to End correction counts (Uncorrected E2E Errors) (Int) : %lu System Data %% life-used : %d %% User data erase counts (Minimum TLC) (Int) : %lu User data erase counts (Maximum TLC) (Int) : %lu User data erase counts (Minimum SLC) (Int) : %lu User data erase counts (Maximum SLC) (Int) : %lu User data erase counts (Average SLC) (Int) : %lu User data erase counts (Average TLC) (Int) : %lu Program Fail Count (Normalized) (Int) : %d Program Fail Count (Raw) (Int) : %lu Erase Fail Count (Normalized) (Int) : %d Erase Fail Count (Raw) (Int) : %lu PCIe Correctable Error Count (Int) : %lu %% Free Blocks (User) (Int) : %d %% Security Version Number (Int) : %lu %% Free Blocks (System) (Int) : %d %% NVMe Stats (# Data Set Management/TRIM Commands Completed) (Int): %s Total Namespace Utilization (nvme0n1 NUSE) (Bytes) : %lu NVMe Stats (# NVMe Format Commands Completed) (Int) : %d Background Back-Pressure Gauge(%%) (Int) : %d Total # of Soft ECC Error Count (Int) : %lu Total # of Read Refresh Count (Int) : %lu Bad System NAND Block Count (Normalized) (Int) : %d Bad System NAND Block Count (Raw) (Int) : %lu Endurance Estimate (Total Writable Lifetime Bytes) (Bytes) : %s Thermal Throttling Status & Count (Number of thermal throttling events) (Int) : %d Total # Unaligned I/O (Int) : %lu Total Physical Media Units Read (Bytes) (Int) : %s Command Timeout (# of READ Commands > 5 Seconds) (Int) : %u Command Timeout (# of WRITE Commands > 5 Seconds) (Int) : %u Command Timeout (# of TRIM Commands > 5 Seconds) (Int) : %u Total PCIe Link Retraining Count (Int) : %lu Active Power State Change Count (Int) : %lu Cloud Boot SSD Spec Version (Int) : %d.%d.%d.%d Cloud Boot SSD HW Revision (Int) : %d.%d.%d.%d Log Page Version (Int) : %d physical_media_units_bytes_tlcphysical_media_units_bytes_slcphysical_media_units_read_bytesactive_power_state_change_count%s: ERROR: WDC: 0xC2 Log Page entry ID 0x%x not found Interval to read the statistics from [1, 15].Log Page Version: 0 = vendor, 1 = WDCLog Page Mask, comma separated list: 0xC0, 0xC1, 0xCA, 0xD0Retrieve additional performance statistics.ERROR: WDC: unsupported log page version for this command ERROR: WDC: log page list is malformed ERROR: WDC: Unknown log page mask - %s ERROR: WDC: Unknown device id - 0x%x ERROR: WDC: Failure reading the C0 Log Page, ret = %d ERROR: WDC: 0xCA Log Page not supported ERROR: WDC: Unable to read CA Log Page data ERROR: WDC: Unsupported Customer id, id = 0x%x program_fail_count : %3u%% %lu erase_fail_count : %3u%% %lu wear_leveling : %3u%% min: %u, max: %u, avg: %u end_to_end_error_detection_count: %3u%% %lu crc_error_count : %3u%% %lu timed_workload_media_wear : %3u%% %-.3f%% timed_workload_host_reads : %3u%% %lu%% timed_workload_timer : %3u%% %lu thermal_throttle_status : %3u%% %u%%, cnt: %u retry_buffer_overflow_count : %3u%% %lu pll_lock_loss_count : %3u%% %lu nand_bytes_written : %3u%% sectors: %.f host_bytes_written : %3u%% sectors: %.f end_to_end_error_detection_count normalizedend_to_end_error_detection_count rawtimed_workload_media_wear normalizedtimed_workload_host_reads normalizedtimed_workload_timer normalizedthermal_throttle_status normalizedretry_buffer_overflow_count normalizedretry_buffer_overflow_count rawpll_lock_loss_count normalizedERROR: WDC: Unknown format - %d ERROR: WDC: Log page 0xCA not supported for this device ERROR: WDC: Failure reading the CA Log Page, ret = %d ERROR: WDC: interval out of range [1-15] C1 Log Page Performance Statistics :- Host Read Commands %20lu Host Read Blocks %20lu Average Read Size %20lf Host Read Cache Hit Commands %20lu Host Read Cache Hit_Percentage %20lu%% Host Read Cache Hit Blocks %20lu Average Read Cache Hit Size %20f Host Read Commands Stalled %20lu Host Read Commands Stalled Percentage %20lu%% Host Write Commands %20lu Host Write Blocks %20lu Average Write Size %20f Host Write Odd Start Commands %20lu Host Write Odd Start Commands Percentage %20lu%% Host Write Odd End Commands %20lu Host Write Odd End Commands Percentage %20lu%% Host Write Commands Stalled %20lu Host Write Commands Stalled Percentage %20lu%% NAND Read Commands %20lu NAND Read Blocks Commands %20lu Average NAND Read Size %20f Nand Write Commands %20lu NAND Write Blocks %20lu Average NAND Write Size %20f NAND Read Before Write %20lu Host Read Cache Hit PercentageHost Read Commands Stalled PercentageHost Write Odd Start Commands PercentageHost Write Odd End Commands PercentageHost Write Commands Stalled PercentageERROR: WDC: Failure reading the C1 Log Page, ret = %d ERROR: WDC: 0xD0 Log Page not supported D0 Smart Log Page Statistics :- Lifetime Reallocated Erase Block Count %20u Lifetime Power on Hours %20u Lifetime UECC Count %20u Lifetime Write Amplification Factor %20u Trailing Hour Write Amplification Factor %20u Reserve Erase Block Count %20u Lifetime Program Fail Count %20u Lifetime Block Erase Fail Count %20u Lifetime Die Failure Count %20u Lifetime Link Rate Downgrade Count %20u Lifetime Clean Shutdown Count on Power Loss %20u Lifetime Unclean Shutdowns on Power Loss %20u Current Temperature %20u Max Recorded Temperature %20u Lifetime Retired Block Count %20u Lifetime Read Disturb Reallocation Events %20u Lifetime NAND Writes %20lu Capacitor Health %20u%% Lifetime User Writes %20lu Lifetime User Reads %20lu Lifetime Thermal Throttle Activations %20u Percentage of P/E Cycles Remaining %20u%% Lifetime Reallocated Erase Block CountLifetime Write Amplification FactorTrailing Hour Write Amplification FactorLifetime Block Erase Fail CountLifetime Link Rate Downgrade CountLifetime Clean Shutdown Count on Power LossLifetime Unclean Shutdowns on Power LossLifetime Read Disturb Reallocation EventsLifetime Thermal Throttle ActivationsPercentage of P/E Cycles RemainingERROR: WDC: Unable to read D0 Log Page data ERROR: WDC: Failure reading the D0 Log Page, ret = %d ERROR: WDC: Invalid C2 log page GUID ERROR: WDC: Unable to read FW Activate History Log Page data Retrieve FW activate history table.ERROR: WDC: %d Log Page not supported INFO: WDC: No FW Activate History entries found. ERROR: WDC: Invalid number entries found in FW Activate History Log Page - %d ERROR: WDC: Failure reading the FW Activate History, ret = %d ERROR: WDC: VUReadBuffer() failed, wdc vsn: %s wdc vsnERROR: WDC Send a Purge command.Purge State Idle.Purge State Done.Purge State Busy.Unknown.Send a Purge Monitor command.Purge state = 0x%0x Purge Progress = %f%% NAND Bytes Written HiNAND Bytes Written LoNAND Bytes Read HiNAND Bytes Read LoNAND Bad Block Count (Raw)Uncorrectable Read CountSystem Data Percent UsedUser Data Erase Counts MaxUser Data Erase Counts MinProgram Fail Count (Raw)Incomplete Shutdown CountePercent Free Blocks Realloc Block Count %u ECC Rate %u Write Amp %u Percent Life Remaining %u Program Fail Count %u Erase Fail Count %u Raw Read Error Rate %u Realloc Block CountECC RateWrite AmpPercent Life RemainingRaw Read Error Ratewith uuid index %d desired namespace id Hardware Revision Log:- ASIC HW Revision : %d ASIC Detailed Info : 0x PCB Detailed Info : 0x DRAM Detailed Info : 0x NAND Detailed Info : 0x PMIC 1 Detailed Info : 0x PMIC 2 Detailed Info : 0x Serial Number : 0x Log Page Version : %d Log page GUID : 0xGlobal Device HW RevisionASIC HW RevisionPCB Manufacturer CodeDRAM Manufacturer CodeNAND Manufacturer CodePMIC 1 Manufacturer CodePMIC 2 Manufacturer CodeOther Component 1 Manf CodeOther Component 2 Manf CodeOther Component 3 Manf CodeOther Component 4 Manf CodeOther Component 5 Manf CodeOther Component 6 Manf CodeOther Component 7 Manf CodeOther Component 8 Manf CodeOther Component 9 Manf Code0x%lx%lxDevice Manf Detailed InfoASIC Detailed InfoPCB Detailed InfoDRAM Detailed InfoNAND Detailed InfoPMIC 1 Detailed InfoPMIC 2 Detailed InfoComponent 1 Detailed InfoComponent 2 Detailed InfoComponent 3 Detailed InfoComponent 4 Detailed InfoComponent 5 Detailed InfoComponent 6 Detailed InfoComponent 7 Detailed InfoComponent 8 Detailed InfoComponent 9 Detailed Info0x%lx%lx%lx%lxNVMe Status:%s(%x) Panic Reset Wait TimePanic Reset ActionDevice Recovery Action 1Panic IDVendor Specific Command CDW12Vendor Specific Command CDW13Device Recovery Action 2Panic CountPrevious Panic ID N-%dLog page GUID Number PCIE Ports : 0x%x Log Page Version : 0x%x Number PCIE PortsWrite Zeros Command SupportSanitize Command SupportDSM Command SupportWrite Uncorr Command SupportFused Command SupportMinimum DSSD Power StateNumber Unsupported Req IDsFeature StatusActive Bucket TimerActive Bucket Timer ThresholdActive Threshold AActive Threshold BActive Threshold CActive Threshold DActive Latency ConfigActive Latency Stamp UnitsStatic Latency Stamp UnitsDebug Telemetry Log SizeDebug Log Trigger EnableGet Drive Status. Drive Status :- Percent Used: %u%% Percent Used: Unknown Drive Life Status: NormalERROR: WDC: Invalid option smart log: %s %4.2Lf NAND Statistics :- SMART Cloud Attributes :- FTL Unit Size : %u TCG Ownership Status : %u Log page GUID (Hex) : 0xbad_user_blocks_normalizedbad_user_blocks_rawxor_recovery_countuncorrectable_read_errorsdetected_e2e_errorsuncorrected_e2e_errorssystem_data_life_used_pctmin_slc_user_data_erase_countmin_tlc_user_data_erase_countmax_slc_user_data_erase_countmax_tlc_user_data_erase_countavg_slc_user_data_erase_countavg_tlc_user_data_erase_countprogram_fail_count_normalizedprogram_fail_count_rawerase_fail_count_normalizederase_fail_count_rawpcie_correctable_errorspct_free_blocks_usersecurity_versionpct_free_blocks_systemnum_of_trim_commandstotal_nuse_bytesnum_of_format_commandsbackground_pressure_gaugesoft_ecc_error_countread_refresh_countbad_system_block_normalizedbad_system_block_rawendurance_est_bytesnum_throttling_eventstotal_unaligned_ionum_read_timeoutsnum_write_timeoutsnum_trim_timeoutspcie_link_retrain_countcloud_boot_ssd_spec_vercloud_boot_ssd_hw_verftl_unit_sizetcg_ownership_statuslog_page_verlog_page_guidlog-page-versionlog-page-maskInvalid output format: %s Invalid Field ID = %d program_fail_count normalizedprogram_fail_count rawerase_fail_count normalizederase_fail_count rawwear_leveling normalizedwear_leveling minwear_leveling maxwear_leveling avgcrc_error_count normalizedcrc_error_count rawtimed_workload_media_wear rawtimed_workload_host_reads rawthermal_throttle_cntpll_lock_loss_count rawnand_bytes_written normalizednand_bytes_written rawhost_bytes_written normalizedhost_bytes_written rawHost Read CommandsHost Read BlocksAverage Read SizeHost Read Cache Hit CommandsHost Read Cache Hit BlocksAverage Read Cache Hit SizeHost Read Commands StalledHost Write CommandsHost Write BlocksAverage Write SizeHost Write Odd Start CommandsHost Write Odd End CommandsHost Write Commands StalledNAND Read CommandsNAND Read Blocks CommandsAverage NAND Read SizeNand Write CommandsNAND Write BlocksAverage NAND Write SizeNAND Read Before WrittenLifetime Power on HoursLifetime UECC CountReserve Erase Block CountLifetime Program Fail CountLifetime Die Failure CountMax Recorded TemperatureLifetime Retired Block CountLifetime NAND WritesLifetime User WritesLifetime User ReadsINFO: WDC: No entries found. N`NNNNĢԢdtwdc_de_VU_read_bufferwdc_vs_telemetry_controller_optionwdc_clear_fw_activate_historywdc_get_fw_act_historywdc_vs_fw_activate_historywdc_get_fw_act_history_C2wdc_get_fw_cust_idwdc_clear_assert_dumpwdc_clear_pcie_correctable_errors/r#,cH2зwdc_get_ocp_c5_log_pageB ɘ]IXK<wdc_get_ocp_c4_log_pageD1!04M=Zwdc_get_ocp_c1_log_pagezЄlpCX^ԅwdc_get_c3_log_pagewdc_vs_device_wafwdc_vs_hw_rev_logwdc_vs_cloud_logwdc_get_c0_log_page_snwdc_get_c0_log_pagewdc_get_ca_log_pagewdc_get_c1_log_pagewdc_get_d0_log_pageeCxxfBmnvme_get_print_c0_eol_logwdc_purge_monitorwdc_purgeP?@CCError Information Log IDNamespace Changed Log IDDevice Self Test Log IDEndurance Group Log IDANA Log IDPersistent Event Log IDDiscovery Log IDSanitize Status Log IDWDC Vendor Unique Log ID C0WDC Vendor Unique Log ID C1WDC Vendor Unique Log ID C2WDC Vendor Unique Log ID C3WDC Vendor Unique Log ID C4WDC Vendor Unique Log ID C5WDC Vendor Unique Log ID C6WDC Vendor Unique Log ID C8WDC Vendor Unique Log ID CAWDC Vendor Unique Log ID CBWDC Vendor Unique Log ID D0WDC Vendor Unique Log ID D1WDC Vendor Unique Log ID D6WDC Vendor Unique Log ID D7WDC Vendor Unique Log ID D8WDC Vendor Unique Log ID DEWDC Vendor Unique Log ID F0WDC Vendor Unique Log ID F1WDC Vendor Unique Log ID F2WDC Vendor Unique Log ID FAUnknown Log IDSend a capabilities command.Send a Resize command.New size: %lu GB The namespace id to resize.op-optionzns identify controllerEnclosure Log Page ID.Get Enclosure Log.OpenFlexwb%s: ERROR: opening:%s: %s args - sz:%x logid:%x of:%s No Log/Crashdump available active_bucket_timer_thresholdactive_threshold_aactive_threshold_bactive_threshold_cactive_threshold_dactive_latency_configactive_latency_minimum_windowdebug_log_trigger_enablediscard_debug_logDiscard Debug Log.Set Latency Monitor feature.active threshold a: 0x%x active threshold b: 0x%x active threshold c: 0x%x active threshold d: 0x%x active latency config: 0x%x discard debug log: 0x%x queue/zonedhost-managedNamespace identifier to usezrwaaselect-allsend command to all zonesOpen zones LBA to flush up toFlush Explicit ZRWA RangeRetrieve NAND statistics. NAND Erase Failures %u E2E Error Counter %lu log page version %u NAND Statistics V3:- TLC Units Written %s SLC Units Written %s Refresh Count %lu Endurance Estimate %s Unaligned I/O %lu NAND Writes TLC (Bytes)NAND Writes SLC (Bytes)NAND Program FailuresNAND Erase FailuresE2E Error CounterBad NAND Blocks Count - RawNAND XOR Recovery countUECC Read Error countProgram Fail Count - RawErase Fail Count - NormalizedErase Fail Count - RawData Set Management Commands%% of completed trimlog page versionRetrieve PCIE statistics. PCIE Statistics :-ECRC Error Status CounterMalformed TLP Status CounterComplete Abort Status CounterPoisoned TLP Status CounterBad DLLP Status CounterBad TLP Status CounterReceiver Error Status CounterSend a vs-drive-info command.Drive HW Revision: %4.1f FTL Unit Size: 0x%x KB Customer SN: %-.*s %4.1fDrive HW RevisionFTL Unit SizeCustomer SNDrive HW Revision: %c.%c Customer SN: %-.*s %c.%cDrive HW RevisonHyperScale Boot Version SpecTCG Device Ownership StatusHW Revision : %u.%u FTL Unit Size : %u hw_revisionWCTEMPCCTEMPDITT supportHCTM supportHCTM Light (TMT1)TMT1 Transition CounterTMT1 Total TimeHCTM Light (TMT2)TMT2 Transition CounterTMT2 Total TimeThermal Shutdown Threshold%s: Invalid format zns identify namespaceClose zones Finish zones Reset zones Offline zones starting LBA of the zonezraZone Receive Actionzrasfpartiallength of data in byteszns zone-mgmt-recvcore_dumpevent_logmanufacturing_infodir-nameDIRECTORYOutput directory pathname.Capture Drive Essentials.DRIVE_ESSENTIALS%s_%s_%s_%sIdentifyController%s%s%s_%s_%s.binIdentifyNamespaceErrorLogSmartLogFwSLotLogLogPage%s%s%s_%s_%s_%s.binFEATURE_ID_%s%s%s0x%x_%s_%s_%s.bin%s%s%s%s%sdumptrace%s/%s%s%s: reason id file = %s Extended SMART InformationRetrieve Log Page Directory.WDC: UUID lists supported 0x%x - %s Log Page Name0x%02X: %s zsasozsazone send actionzns zone-mgmt-sendzns set-zone-descCommand Supported and EffectsSmart/Health Information Log IDFirmware Slot Information Log IDCommamds Supported and Effects Log IDTelemetry Host Initiated Log IDTelemetry Controller Generated Log IDReservation Notification Log IDWDC Plugin Capabilities for NVME device:%s cap-diag : %s drive-log : %s get-crash-dump : %s get-pfail-dump : %s id-ctrl : Supportedpurge : %s purge-monitor : %s vs-internal-log : %s vs-nand-stats : %s vs-smart-add-log : %s --C0 Log Page : %s --C1 Log Page : %s --C3 Log Page : %s --CA Log Page : %s --D0 Log Page : %s clear-pcie-correctable-errors : %s drive-essentials : %s get-drive-status : %s clear-assert-dump : %s drive-resize : %s vs-fw-activate-history : %s clear-fw-activate-history : %s vs-telemetry-controller-option: %s vs-error-reason-identifier : %s log-page-directory : %s namespace-resize : %s vs-drive-info : %s vs-temperature-stats : %s cloud-SSD-plugin-version : %s vs-pcie-stats : %s get-error-recovery-log : %s get-dev-capabilities-log : %s get-unsupported-reqs-log : %s get-latency-monitor-log : %s cloud-boot-SSD-version : %s vs-cloud-log : %s vs-hw-rev-log : %s vs-device_waf : %s set-latency-monitor-feature : %s capabilities : SupportedGet Cloud SSD Plugin Version command.WDC Cloud SSD Plugin Version: 1.0The new size (in GB) to resize the drive to.The over provisioning option to set for namespace.Send a Namespace Resize command.ERROR: WDC: unsupported OP option parameter ERROR: WDC: Namespace Resize of namespace id 0x%x, op option 0x%x failed Send a ZNS specific Identify Controller command to the given device and report information about the specified controller in various formats.Get Ymtc vendor specific additional smart log (optionally, for the specified namespace), and show it.crc_error_count : %3d%% %u thermal_throttle_status : %3d%% %d%%, cnt: %u tempt_since_born : %3d%% max: %u, min: %u, curr: %u power_consumption : %3d%% max: %u, min: %u, curr: %u tempt_since_bootup : %3d%% max: %u, min: %u, curr: %u read_fail : %3d%% %lu thermal_throttle_time : %3d%% %u, time: %u Get Cloud Boot SSD Version command.HyperScale Boot Version: %d.%d ERROR: WDC: Unable to read Extended Smart/C0 Log Page data ERROR: WDC: unsupported WDC enclosure, Model = %s Invalid log identifier: %d. Valid 0xd1, 0xd2, 0xd3, 0xd4, 0xe2, 0xe4 %s: WARNING : WDC: No log ID:x%x available %s: ERROR: WDC: NVMe Snd Mgmt %s: ERROR: WDC: NVMe Rcv Mgmt %s: ERROR: WDC: NVMe Rcv Mgmt response size:x%x not LW aligned ERROR: 0x%x Failed to collect log-id:%x %s: ERROR: xfer-size (%d) must be a power of 2 This is the value that loads the Active Bucket Timer Threshold.This is the value that loads into the Active Threshold A.This is the value that loads into the Active Threshold B.This is the value that loads into the Active Threshold C.This is the value that loads into the Active Threshold D.This is the value that loads into the Active Latency Configuration.This is the value that loads into the Active Latency Minimum Window.This is the value that loads into the Debug Log Trigger Enable.latency_monitor_feature_enableLatency Monitor Feature Enable.NVME_FEAT_OCP_LATENCY_MONITOR: 0x%02x active bucket timer threshold: 0x%x active latency minimum window: 0x%x debug log trigger enable: 0x%x latency monitor feature enable: 0x%x %-21s %-20s %-40s %-9s %-26s %-16s %-8s %-.21s %-.20s %-.40s %-.9s %-.26s %-.16s %-.8s Failed to scan nvme subsystems starting LBA of the zone for this commandAllocate Zone Random Write Area to zonezns-open-zone: Success zone slba:%lx nsid:%d zrwa-flush-zone: Success, lba:%lx nsid:%d ERROR: WDC: %s: failure to get pci ids, ret = %d ERROR: WDC: %s : Failed to retrieve NAND stats ERROR: WDC: %s : invalid output format NAND Writes TLC (Bytes) %s NAND Writes SLC (Bytes) %s NAND Program Failures %u Bad Block Count %u NAND XOR/RAID Recovery Trigger Events %lu Number Successful NS Resizing Events %lu Bad NAND Blocks Count - Normalized %u Bad NAND Blocks Count - Raw %lu NAND XOR Recovery count %lu UECC Read Error count %lu SSD End to End corrected errors %lu SSD End to End detected errors %u SSD End to End uncorrected E2E errors %u System data %% life-used %u User Data Erase Counts - TLC Min %lu User Data Erase Counts - TLC Max %lu User Data Erase Counts - SLC Min %lu User Data Erase Counts - SLC Max %lu Program Fail Count - Normalized %u Program Fail Count - Raw %lu Erase Fail Count - Normalized %u Erase Fail Count - Raw %lu PCIe Correctable Error Count %u %% Free Blocks (User) %u Security Version Number %lu %% Free Blocks (System) %u Data Set Management Commands %s Estimate of Incomplete Trim Data %lu %% of completed trim %u Background Back-Pressure-Guage %u Soft ECC Error Count %lu Bad System Nand Block Count - Normalized %u Bad System Nand Block Count - Raw %lu Thermal Throttling Count %u Thermal Throttling Status %u Physical Media Units Read %s WDC: Nand Stats ERROR: Invalid version Number Successful NS Resizing EventsBad NAND Blocks Count - NormalizedSSD End to End corrected errorsSSD End to End detected errorsSSD End to End uncorrected E2E errorsUser Data Erase Counts - TLC MinUser Data Erase Counts - TLC MaxUser Data Erase Counts - SLC MinUser Data Erase Counts - SLC MaxProgram Fail Count - NormalizedEstimate of Incomplete Trim DataBackground Back-Pressure-GuageBad System Nand Block Count - NormalizedBad System Nand Block Count - Raw%s: Invalid Stats Version = %d ERROR: WDC: Failure reading NAND statistics, ret = %d ERROR: WDC: PCIE Stats alloc: %s ERROR: WDC: Failure reading PCIE statistics, ret = 0x%x Unsupported Request Error Counter %20lu ECRC Error Status Counter %20lu Malformed TLP Status Counter %20lu Receiver Overflow Status Counter %20lu Unexpected Completion Status Counter %20lu Complete Abort Status Counter %20lu Completion Timeout Status Counter %20lu Flow Control Error Status Counter %20lu Poisoned TLP Status Counter %20lu Dlink Protocol Error Status Counter %20lu Advisory Non Fatal Error Status Counter %20lu Replay Timer TO Status Counter %20lu Replay Number Rollover Status Counter %20lu Bad DLLP Status Counter %20lu Bad TLP Status Counter %20lu Receiver Error Status Counter %20lu Unsupported Request Error CounterReceiver Overflow Status CounterUnexpected Completion Status CounterCompletion Timeout Status CounterFlow Control Error Status CounterDlink Protocol Error Status CounterAdvisory Non Fatal Error Status CounterReplay Timer TO Status CounterReplay Number Rollover Status CounterERROR: WDC %s invalid output format ERROR: WDC %s: Identify Controller failed ERROR: WDC: %s: failure to get hw revision log ERROR: WDC: %s: failure to get extended smart cloud log Drive HW Revision: %2d FTL Unit Size: %d HyperScale Boot Version Spec: %d.%d TCG Device Ownership Status: %2d ERROR: WDC: capability not supported by this device Send a vs-temperature-stats command.Temperature Stats for NVME device:%s namespace-id:%x Current Composite Temperature : %d °C WCTEMP : %u °C CCTEMP : %u °C DITT support : 0HCTM support : %u HCTM Light (TMT1) : %u °C TMT1 Transition Counter : %u TMT1 Total Time : %u HCTM Heavy (TMT2) : %u °C TMT2 Transition Counter : %u TMT2 Total Time : %u Thermal Shutdown Threshold : 95 °CSend a ZNS specific Identify Namespace command to the given device and report information about the specified namespace in varios formats.%s: Success, action:%d zone:%lx all:%d zcapc:%u nsid:%d Zone Receive Action Specific Field(Reporting Options)Zone Receive Action Specific Features(Partial Report)error: data len is needed for NVME_ZRA_ZONE_REPORT could not alloc memory for zone mgmt receive datazone-mgmt-recv: Success, action:%d zone:%lx nsid:%d ERROR: WDC: get serial # and fw revision failed Get Drive Essentials Data for device serial #: %s and fw revision: %s Store Drive Essentials bin files in directory: %s ERROR: WDC: nvme_identify_ctrl() failed, ret = %d ERROR: WDC: nvme_identify_ns() failed, ret = %d ERROR: WDC: nvme_error_log() failed, ret = %d ERROR: WDC: nvme_smart_log() failed, ret = %d ERROR: WDC: nvme_fw_log() failed, ret = %d ERROR: WDC: nvme_get_log() for log page 0x%x failed, ret = %d ERROR: WDC: nvme_get_feature id 0x%x failed, ret = %d ERROR: WDC: %s: Failed to get headerPayloadSize from file directory 0x%x ERROR: WDC: %s: Failed to get fileIdOffsets from file directory 0x%x WDC: wdc_get_log_dir_max_entries failed, ret = %d ERROR: WDC: %s: Failed to get filesystem directory size, ret = %d ERROR: WDC: %s: Failed to get filesystem directory, ret = %d WDC: wdc_fetch_log_directory failed, ret = %d ERROR: WDC: File Size for %s is 0 ERROR: WDC: %s: wdc_de_VU_read_buffer failed with ret = %d, fileId = 0x%x, fileSize = 0x%lx ERROR: WDC: wdc_fetch_log_file_from_device: %s failed, ret = %d ERROR: WDC: %s: wdc_de_VU_read_size failed with ret = %d ERROR: WDC: %s: wdc_de_VU_read_size failed, read size is less than 4 bytes, dumptraceSize = 0x%x ERROR: WDC: %s: readBuffer calloc failed ERROR: WDC: %s: wdc_de_VU_read_buffer failed, ret = %d on offset 0x%x ERROR: WDC: %s: Read Buffer Loop failed, ret = %d ERROR: WDC: %s: wdc_WriteToFile failed, ret = %d ERROR: WDC: wdc_de_get_dump_trace failed, ret = %d ERROR: WDC: Tar of Drive Essentials data failed, ret = %d Get of Drive Essentials data successful Log ID to retrieve - host - 7 or controller - 8File name to save raw binary identifierRetrieve telemetry log reason identifier.ERROR: WDC: Invalid Log ID. It must be 7 (Host) or 8 (Controller) _error_reason_identifier_ctlr_%s_error_reason_identifier_host_%s%s: ERROR: malloc failed, size : 0x%x, status: %s %s: ERROR: Failed to acquire telemetry header, ret = %d! %s: ERROR: get telemetry header failed, ret : %d %s: ERROR: failed to get drive reason id %s: ERROR: failed to mkdir %s: %s ERROR: WDC:unsupported device for this command Output Format: normal|json|binary%s: ERROR: WDC: invalid output format WDC: UUID lists NOT supported %s: ERROR: WDC: 0x%x Log Page not supported %s: ERROR: WDC: NULL_data ptr %s: ERROR: WDC: Invalid format, format = %s can not allocate log page directory payload starting LBA of the zone for this command(for flush action, last lba to flush)Zone Send Action Specific Optionzone send action must be specified Zone Descriptor Extensions are not supported data, data_len only valid with set extended descriptor zone-mgmt-send: Success, action:%d zone:%lx all:%d nsid:%d optional file for zone extension data (default stdin)Set Zone Descriptor Extension zone format does not provide descriptor extension could not alloc memory for zone descset-zone-desc: Success, zone:%lx nsid:%d (0  ط зȷ x ph `XP H @80 (zone_mgmt_recvzrwa_flush_zoneset_zone_descopen_zonezone_mgmt_sendzns_mgmt_sendid_nsid_ctrl----------------------------------------------------------------------------------------------------show_ymtc_smart_logget_additional_smart_logwdc_CheckUuidListSupportwdc_set_latency_monitor_featurewdc_enc_get_nic_logwdc_enc_submit_move_datawdc_enc_get_logwdc_cloud_boot_SSD_versionwdc_vs_temperature_statswdc_do_drive_infowdc_vs_drive_infowdc_do_vs_pcie_statswdc_do_vs_nand_stats_sn810_2wdc_print_nand_stats_jsonwdc_do_vs_nand_statswdc_vs_nand_statswdc_log_page_directorywdc_dump_telemetry_hdrwdc_save_reason_idwdc_do_get_reason_idwdc_reason_identifierwdc_do_namespace_resizewdc_do_drive_resizewdc_de_get_dump_tracewdc_fetch_log_file_from_devicewdc_fetch_log_directorywdc_get_log_dir_max_entrieswdc_get_serial_and_fw_revwdc_do_drive_essentials?/usr/local/nvmecSSSTC Smart log#idguard check errorapplication tag check errorreference tag check errorend_to_end_error_dect_countNAND_ECC_detection_countNAND_ECC_correction_countGC_count1-Bit Err2-Bit ErrDRAM_UECC_detection_countparity error detectedecc error detectionaxi data parity errorsSRAM_UECC_Detection_Countraid_Recovery_fail_countRead CmdWrite CmdAdmin CmdInflight_Commandread hcrcwrite hcrcwear_leveling_exec_countstripeSize%-10s: %u %-10s: %.*s linkSpeednegLnkWdthsecCapabsecStatusbootLoaderwwid%-10s: 0x%016lx bwLimGranioLimGransignature%-10s: 0x%08X %-10s: 0x%02X prodTypenandTypeformFactorfwStatusP4RevisioncustomerIDusageModelznsNVMemfndNVMecdw14map13vpdAvail%-16s%s wall-time%-*sentry# Log page version:%-24s %u.%u Sample period(ms):%-24s %u timestamp_lastChange:%-24s %lu timestamp_triggered:config:%-24s 0x%x Triggerthreshold:ValueTriggered:Tracker Type:%-24s %s Total log page entries:Trigger count:Poll count:%-24s %ld %-16llu%Y-%m-%d-%H:%M:%S%s.%06lu %-*iBad field size%-*u PSID: Re-enter New Password: Error: passwords don't match Method returned no statusUnknown Errorinitialize: SED error - %s Lock a SED deviceUnlock a SED deviceunlock: SED error - %s password: SED error - %s %cAre you sure (y/n)? Aborting PSID revert PSID_REVERT_TPR rc %d Aborting destructive revert Error: revert TPR - %d revert: SED error - %s Locking Features:output Format: normal|jsonERROR : OCP : malloc : %s unhandled output format Could not get feature: 0xC6unrecognizedEvent Class : %s Size : 0x%02x %04d:%02d:%02d Event ID : 0x%04x %s Timestamp : %s VU Data : 0x Event ID : 0x%04x %s State : 0x%02x %s Speed : 0x%02x %s Width : 0x%02x %s VU Data : Cmd Op Code : 0x%02x Status Code : 0x%04x Cmd ID : 0x%04x SQ ID : 0x%04x CC Reg Data : 0x%08x CSTS Reg Data : 0x%08x Host TB Written : 0x%04x Media TB Written : 0x%04x Media TB Erased : 0x%04x telemetry-log is empty. Invalid LogPageId [0x%02X] Failed to read string-log. string-log is empty. Invalid output format no-uuidstate of zones to listshow report zones verbosityextendedset to use the partial reportzns report-zoneszslbafile containing data to writepiremapAppend size not provided Invalid value for prinfo:%#x read-dataread-metadatazns zone-appendNo memory for data size:%lx retain an asynchronous eventzns changed-zone-listinvalid-namespace-idrelocatable_sector_counttimed_work_load_host_readstimed_work_load_timerre_sku_counthost_read_collision_counthost_write_collision_count%-*d%-*d startUUID-idx: %d Average Latency: %lu OCP Latency MonitorEndurance Manager StatisticsTemperature StatisticsSMART AttributesGet Power Usage Log PageVt Histo Get Log PageWorkload Tracker Get Log PageLatency Outlier Log Page%s/%s/%sSuccessfully wrote %s to %s Id Controller DataHost Initiated Telemetryrun_time: %lluus 0x%08XWrite through mode (WTM)SaveNot saveRead only mode (ROM)Normal mode[0-3]: default/rom/wtm/normalDefine EOL/PLP failure modeCould not get feature: %#0*x.telemetry-profile-selectSet Telemetry Profilepower-stateDefine DSSD Power StateDSSD Power State: 0x%x Save bit Value: 0x%x plp_health_intervalASCII Table Size = %lu stat_id_str_table_ofst = %lu event_str_table_ofst = %lu ascii_table_ofst = %lu total_log_page_sz = %lu Host(0)Host(1)String log binary; 'C9.bin'telemetry-typehost0host1string.binStatus:(%x) Reason Identifier :Major Version : 0x%x Minor Version : 0x%x Timestamp : %lu Log Page GUID : 0xTelemetry_%s_Area_%d%d%% NVMe Status: %s(%x) Outstanding Admin CommandsHost Write BandwidthActive NamespacesInternal Write WorkloadInternal Read WorkloadInternal Write Queue DepthInternal Read Queue DepthPending Trim LBA CountHost Trim LBA Request CountCurrent NVMe Power StateCurrent DSSD Power StateRead Disturb WriteRetention WritesWear Leveling WritesRead Recovery WritesGarbage Collection WritesSRAM Correctable CountDRAM Correctable CountSRAM Uncorrectable CountDRAM Uncorrectable CountData Integrity Error CountRead Retry Error CountPERST Events CountMax Die Bad BlockMax NAND Channel Bad BlockMin NAND Channel Bad BlockXOR Recovery InvokedUncorrectable Media ErrorPlane Failure EventAssert in Media CodeAssert in Security CodeFTL Rebuild FailedFTL Data MismatchFTL Other CodeMain Firmware Boot CompleteFTL Load from NVM CompleteFTL Rebuild StartedFTL Rebuild CompletePCIE Conventional Hot ResetMain Power_CyclePERSTPCIE Function Level ResetNVMe Subsytem ResetCC.EN Transitions from 0 to 1CC.EN Transitions from 1 to 0Reserved NVMe Event IDCC Register ChangedCTS Register ChangedPCIe Link Width x1PCIe Link Width x2PCIe Link Width x4PCIe Link Width x8PCIe Link Width x16PCIe Link Speed Gen1PCIe Link Speed Gen2PCIe Link Speed Gen3PCIe Link Speed Gen4PCIe Link Speed Gen5PCIe Link Speed Gen6PCIe Link Speed Gen7PCIe State UnchainedPCIe Speed ChangedPCIe Width ChangedPCIe Link UpPCIe Link DownPCIe Error DetectedPCIe PERST AssertedPCIe PERST DeassertedPCIe Refclk StablePCIe Vmain StablePCIe Link NegotiatedTimestamp Host Cmd IssuedTimestamp SnapshotTimestamp Power on HoursTimestamp ClassPCIe ClassNVMe ClassReset ClassBoot Sequence ClassFW Assert ClassTemperature ClassMedia Debug ClassMedia Wear ClassStatistic Snapshot Classask-keydestructivedestructive revertpsidPSID revertHost Not AuthorizedObsoleteSP Session BusySP FailedSP DisabledSP FrozenNo Sessions AvailableUniqueness ConflictInsufficient SpaceInsufficient RowsInvalid ParameterTPER MalfunctionTransaction FailureResponse OverflowAuthority Locked OutBaseCmdQPatternRandSeqThrottleDefraghostReadsHost Read Count in SectorshostWritesHost Write Count in SectorsnandWritesNand Write Count in Sectorsmisalignment%% of Misaligned Sectorscollision%% of Colliding SectorsrandomWrite%randomRead%xorInvokedCounthostSoftReadSuccessbandDefragRelocationCount of BDRspwrThrottle%thmThrottle%tbufBg%tbufHost%CmdQ_InternalReadQDepthCmdQ_DetectedWriteQDepthCmdQ_ReadCmdsPendingCmdQ_WriteCmdsPendingCmdQ_ReadCmdsOutstandingCmdQ_WriteCmdsOutstandingx11223300x44556600_x77889900_xAABBCC00_xDD00xEE00xFF00x0_x80x__x8_x33322100randomReadCmdrandomWriteCmdhostReadCmdhostWriteCmdrandomThrottleRead%pwrThrottleOn_msthmThrottleOn_mspowerOn_usDuration of Power-on in uS.vin1Powerin uWvin2PowernandReadsNand Read Count in SectorslastNandAvgPwrlastDriveAvgPwrNscPwgSysCreditCntburstPowerBudgetCurrent defragSlotshostSlotstotalSlotsTotal slotshostBufferUse%defragBufferUse%defragSlotsUse%hostSlotsUse%aiuUse%isImminentFRorWLdefragTypedefrag typeGet SSSTC vendor specific additional smart log (optionally, for the specified namespace), and show it.internal_end_to_end_dect_countkey #id normalized rawprogram_fail_count : %03d %3d%% %lu erase_fail_count : %03d %3d%% %lu wear_leveling : %03d %3d%% min: %u, max: %u, avg: %u end_to_end_error_dect_count : %03d %3d%% guard check error: %u, application tag check error: %u, reference tag check error: %u crc_error_count : %03d %3d%% %lu nand_bytes_written : %03d %3d%% sectors: %lu host_bytes_written : %3d %3d%% sectors: %lu reallocated_sector_count : %03d %3d%% %lu uncorrectable_sector_count : %03d %3d%% %lu NAND_ECC_detection_count : %03d %3d%% %lu NAND_ECC_correction_count : %03d %3d%% %lu GC_count : %03d %3d%% %lu DRAM_UECC_detection_count : %03d %3d%% 1-Bit Err: %u, 2-Bit Err: %u SRAM_UECC_Detection_Count : %03d %3d%% parity error detected: %u, ecc error detection: %u, axi data parity errors: %u raid_recovery_fail_count : %03d %3d%% %lu Inflight_Command : %03d %3d%% Read Cmd: %u, Write Cmd: %u, Admin Cmd: %u internal_end_to_end_dect_count : %03d %3d%% read hcrc: %u, write hcrc: %u, reserved: %u die_fail_count : %03d %3d%% %lu wear_leveling_exec_count : %03d %3d%% %lu read_disturb_count : %03d %3d%% %lu data_retention_count : %03d %3d%% %lu Warning : No valid workload log data Temporarily enabling tracker to find current timestampOriginal config value: 0x%08x Modified config value: 0x%08x Failed to retrieve latest SSD timestampRestored config value: 0x%08x ERROR : The NVMe block device must be specified Error: failed to take device ownership - %d Error: failed to activate LSP - %d Error: failed to setup locking range - %d Error: failed setting password - %d Initialize a SED device for lockingError: failed locking or unlocking - %d Warning: failed re-reading partition Error: failed setting SID password - %d Change the locking password of a SED deviceDestructive revert erases drive data. Continue (y/n)? Error: failed reverting drive - %d Revert a SED device from locking stateError: ioctl IOC_OPAL_DISCOVERY failed Error: device does not support SED Opal Locking Supported: %s Locking Feature Enabled: %s Locked: %s Query SED device and display locking featuresERROR : OCP : invalid output format ERROR : OCP : Unknown GUID in C3 Log Page data ERROR : OCP : Expected GUID: 0x ERROR : OCP : Actual GUID: 0xERROR : OCP : Unable to read C3 data from buffer ERROR : OCP : Failure reading the C3 Log Page, ret = %d ERROR : OCP : Unknown GUID in C5 Log Page data ERROR : OCP : Failure reading the C5 Log Page, ret = %d output Format: normal|json|binaryRetrieve C1h Error Recovery Log data.ERROR : OCP : Unknown GUID in C1 Log Page data ERROR : OCP : Unable to read C1 data from buffer ERROR : OCP : Failure reading the C1h Log Page, ret = %d Retrieve C4h Device Capabilities Log data.ERROR : OCP : Unknown GUID in C4 Log Page data ERROR : OCP : Unable to read C4 data from buffer ERROR : OCP : Failure reading the C4h Log Page, ret = %d [0-3,8]: current/default/saved/supported/changedDefine Issue Get Feature command (FID : 0xC6) PLP Health Check Intervalget-feature:0xC6 %s value: %#08x ============ Telemetry Host Data Area %d Statistics ============ ========= Telemetry Controller Data Area %d Statistics ========= =============================================== ========= Telemetry Host Data area %d Event FIFO %d ========= ====== Telemetry Controller Data area %d Event FIFO %d ====== Event ID : 0x%04x %s Statistic ID : 0x%02x %s Failed to read telemetry-log. [0-3]: current/default/saved/supported/Print out all 3 values at once - Current, Default, and SavedSkip UUID index search (UUID index not required for OCP 1.0)Define DSSD Power State (Feature Identifier C7h) Get Feature.Required to have --sel as an argument, or pass the --all flag.number of descriptors to retrieve (default: all of them)set to use the extended report zonesRetrieve the Report Zones data structurefile with metadata to be writtenlogical block application tag mask for end-to-end PIlogical block application tag for end-to-end PIprotection information action and checks fieldprotection information remap (for type 1 PI)The zone append command is used to write to a zone using the slba of the zone, and the write will be appended from the write pointer of the zoneData size:%#lx not aligned to lba size:%#x Metadata size:%#lx not aligned to metadata size:%#x latency: zone append: %llu us Success appended data to LBA %lx No memory for metadata size:%d Retrieve Changed Zone log for the given deviceread_commands_in_flight_counterwrite_commands_in_flight_counterSolidigm IO %s Command Latency Tracking Statistics type %d Major Revision: %u Minor Revision: %u OCP SMART / Health Information ExtendedRead Commands Latency StatisticsWrite Commands Latency StatisticsVU NVMe IO Queue Metrics Log PageVU Marketing Description Log PagePerformance Rating and LBA Access HistogramGarbage Control Collection Log Pagecntid_0_cns_%d_nsid_%d_nvmsetid_0_csi_0.binlid_0x07_lsp_0x01_lsi_0x0000.binlid_0x08_lsp_0x00_lsi_0x0000.binController Initiated TelemetryValue offset greater than binary size (%u > %zu).Value crossing 64 bit, byte aligned boundary, not supported. size_bit=%u, offset_bit_from_byte=%u.Specifies that the controller shall save the attributeDefine EOL or PLP circuitry failure mode. No argument prints current mode.ERROR: No OCP UUID index foundSuccessfully set mode (feature: %#0*x): %#0*x (%s: %s).End of Life Behavior (feature: %#0*x): %#0*x (%s: %s)Telemetry Profile Select for device debug data collectionSet Telemetry Profile (Feature Identifier C8h) Set Feature.Successfully Set Telemetry Profile (feature: 0xC8) to below valuesTelemetry Profile Select: 0x%x Telemetry Profile Select is a required argumentDSSD Power State to set in wattsDefine DSSD Power State (Feature Identifier C7h) Set Feature.Successfully set DSSD Power State (feature: 0xC7) to below values[31:16]:PLP Health Check IntervalDefine Issue Set Feature command (FID : 0xC6) PLP Health Check IntervalDefine PLP Health Check IntervalSuccessfully set the PLP Health Check IntervalPLP Health Check Interval: 0x%x Statistics Identifier String Table Size = %lu Event String Table Size = %lu VU Event String Table Size = %lu vu_event_str_table_ofst = %lu ERROR : OCP : Unable to read C9 data. Telemetry log binary; 'host.bin' or 'controller.bin'Output file name with path; e.g. '-o ./path/name' '-o ./path1/path2/'; If requested path does not exist, the directory will be newly created.Telemetry Data Area; 1 or 2; e.g. '-a 1 for Data Area 1.' '-a 2 for Data Areas 1 and 2.'; Telemetry Type; 'host' or 'controller'Retrieve and parse OCP Telemetry log.Missing data-area. Using default data area 1. Invalid data-area specified. Please specify 1 or 2. telemetry-type should be host or controller. Missing telemetry-type. Using default - host. Failed to fetch the log from drive. Failed to fetch telemetry-header. Error:%d. Failed to write data to file. Failed to fetch telemetry-log. Failed to fetch telemetry-log from the drive. telemetry.bin generated. Proceeding with next steps. Missing string-log. Fetching from drive... Failed to fetch string-log from the drive. string.bin generated. Proceeding with next steps. Missing format. Using default format - JSON. Extracting Telemetry Host Dump (Data Area %d)... Extracting Telemetry Controller Dump (Data Area %d)... Extracting Telemetry Host(%d) Dump (Data Area %d)... get_telemetry_header failed, err: %d. ============ Telemetry Host Header ============Log Identifier : 0x%02X IEEE : 0x%02X%02X%02X Data Area 1 Last Block : 0x%04X Data Area 2 Last Block : 0x%04X Data Area 3 Last Block : 0x%04X Data Available : 0x%02X Data Generation Number : 0x%02X get_telemetry_data failed for type: 0x%x, err: %d. ============ Telemetry Host Data area 1 ============Number Telemetry Profiles Supported : 0x%x Telemetry Profile Selected (TPS) : 0x%x Telemetry String Log Size (SLS) : 0x%lx Firmware Revision : Data Area 1 Statistic Start : 0x%lx Data Area 1 Statistic Size : 0x%lx Data Area 2 Statistic Start : 0x%lx Data Area 2 Statistic Size : 0x%lx Event FIFO %d Data Area : 0x%x Event FIFO %d Start : 0x%lx Event FIFO %d Size : 0x%lx SMART / Health Information :SMART / Health Information Extended :get_telemetry_data da1 stats failed, err: %d. Get DA 1 FIFO addr: %p, offset 0x%lx get_telemetry_data da1 event fifos failed, err: %d. get_telemetry_data da2 stats failed, err: %d. get_telemetry_data da2 event fifos failed, err: %d. ------------------------------FIFO End---------------------------Telemetry %s Area %d is empty. 100%% The log file was saved at "%s" ocp internal-log command completed. Missing telemetry-log. Fetching from drive... Garbage Collection Write BandwidthBlock Marked Bad Due to Program ErrorBlock Marked Bad Due to Erase ErrorBlock Marked Bad Due to Read ErrorComposite Temp Decreases to (WCTEMP-2)Composite Temp Increases to WCTEMPComposite Temp Increases to CCTEMPAssert in NVMe Processing CodeAssert in Background Services CodeCSTS.RDY Transitions from 0 to 1CSTS.RDY Transitions from 1 to 0Create IO SQ or CQ Command ProcessedOther Admin Queue Command ProcessedAdmin Command Returned Non-zero StatusIO Command Returned Non-zero StatusCSTS.CFS Transitions from 0 to 1Admin SQ or CQ Base Address WrittenDelete IO SQ or CQ Command Processedprompt for SED authentication key% of Random Write Sectors vs. Sequential% of Random Read Sectors vs. SequentialCount of XOR Operations InvokedCount of Soft Reads Completed Successfully.% of Throttle Period due to Power Regulation% of Throttle Period due to Thermal Levels% of Background TBUF Work vs. All Available Work% of Host Requested TBUF Work vs. All Available WorkSnapshot of the Internal Read Queue DepthSnapshot of the Internal Write Queue DepthSnapshot of the Internal Read Commands PendingSnapshot of the Internal Write Commands PendingSnapshot of the Internal Read Commands OutstandingCount of Random Read Commands (vs. Sequential)Count of Random Write Commands (vs. Sequential)Count of Total Host Read Commands (vs. Sequential)Duration of Power Throttling in mS.Duration of Thermal Throttling in mS.% of WCM_GetHostBuffersInUse to WCM_GetDesiredHostBuffer% of defragBuffer to Desired defrag buffer %defragSlots to Total defrag slots %hostSlots to Total defrag slots %% of AvailableIndirectionUnits to Start Setpoint IUdefrag/Wear leveling is imminentp_c baha0aa`p`_ _č<tdTD4$ԌČtdTDget_plp_health_check_intervalset_plp_health_check_intervalset_dssd_power_stateocp_set_telemetry_profileget_c4_log_pageget_c1_log_pageget_c5_log_pageget_telemetry_log_page_dataextract_dump_get_logocp_telemetry_logget_c9_log_page_dataeol_plp_failure_mode_seteol_plp_failure_mode_getocp_set_latency_monitor_featureget_c3_log_page[G)Voocp_get_uuid_indexilog_dump_telemetryilog_dump_identify_pageget_supported_log_pages_logssstc_get_add_smart_logchanged_zone_listzone_appendreport_zonesValue with size_bit=0 not supporController ASIC componentDRAM ComponentPMIC ComponentPCB Componentcapacitor componentregistor componentcase componentDevice Serial NumberCountry of OriginVendor Unique ComponentNAND ComponentFirmware History Log:log identifier: %-26s%d valid entries: entries:log page version:log page guid: %-26s0x%lx%lx entry[%d]: version number: %-22s%d entry length:activation count:timestamp: %-22s%lu power cycle count:previous firmware: %-22s%.*s new firmware:slot number:commit action type:result: Previous Panic IDs: %s Panic ID N-%d : 0x%lx Log page GUID : 0xrsvd1 : %04x nsid : %08x cdw2 : %08x cdw3 : %08x data_len : %08x metadata_len : %08x cdw10 : %08x cdw11 : %08x cdw12 : %08x cdw13 : %08x cdw14 : %08x cdw15 : %08x timeout_ms : %08x enable-panic-notices[0]:Enable Panic NoticesCould not get feature: 0xC9 Data Area 1 StatisticsData Area 2 StatisticsUnsupported Data Area:[%d]Log Identifier: 0x%02xh Log Page Version: 0x%x Reserved2Reserved48Component Descriptions Component %d: %s Date/Lot Size: 0x%lx Identifier: 0x%08x Manufacture: 0x%016lx Revision: 0x%016lx Date/Lot Code Additional Information Controller : %s Deallocate/Trim%64s%92s%119s %s FIFO 1 ASCII String %d %d %c FIFO 2 ASCII String FIFO 3 ASCII String FIFO 4 ASCII String FIFO 5 ASCII String FIFO 6 ASCII String FIFO 7 ASCII String FIFO 8 ASCII String FIFO 9 ASCII String FIFO 10 ASCII String FIFO 11 ASCII String FIFO 12 ASCII String FIFO 13 ASCII String FIFO 14 ASCII String FIFO 15 ASCII String FIFO 16 ASCII String ASCII TableLog IdentifierHardware Component Log SizeComponent %dDate/Lot SizeAdditional Information Size0x%0*lxManufactureManufacture CodeActive Latency ConfigurationActive Latency Minimum WindowNADebug Log Measured LatencyDebug Log Latency Time StampDebug Log PointerDebug Counter Trigger SourceDebug Log Stamp Unitslog identifiervalid entrieslog page guidversion numberentry lengthactivation countpower cycle countprevious firmwareslot numbercommit action typePCI Express PortsOOB Management SupportWrite Zeroes Command SupportFused Operation SupportDSSD Power State DescriptorsTelemetry String Log SizeVU Event String Table StartVU Event String Table SizeASCII Table StartASCII Table SizeASCII ID LengthASCII ID offsetDebug Event ClassVU Event IdentifierReserved1Locking SP Activation CountTper Revert CountNumber of Locking ObjectsSID Authentication Try CountSID Authentication Try LimitProgrammatic TCG Reset CountProgrammatic Reset Lock CountTCG Error CountReserved3Success : %s Fail : %s VU Event ID : 0x%02x VU Data : 0x%s : 0xData Area 1 Event FIFO infoData Area 2 Event FIFO infoInput buffer was NULLEVENT FIFO %s%d%s%s - %s%s %sDebug Event Class typeEvent Data SizeVU Data%s: 0x%x Class Specific DataVU Event Stringarg --%s[=<%s>]=<%s> -%c [<%s>] <%s>--- Usage: %s Options: shortlong integerlong suffixed integerfloat%s out of range result : %08x err : %d latency : %lu us result : %lx CPU/controller hangNAND hangPLP defectlogical firmware errorDRAM corruption critical pathNAND corruptionSRAM corruptionHW malfunctionno more NAND spares availableincomplete shutdown, Single instanceReturn set of error injectionError injection typenrtdpInject error conditionsset-error-injection: %s XOR recovery count %lu Refresh counts %lu Incomplete shutdowns %u Percent free blocks %d Capacitor health %u Unaligned I/O %lu PLP start count %s Endurance estimate %s Log page version %u Log page GUID 0xhiPhysical media units writtenPhysical media units readBad user nand blocks - RawBad system nand blocks - RawXOR recovery countSoft ecc error countEnd to end detected errorsEnd to end corrected errorsSystem data percent usedRefresh countsMax User data erase countsMin User data erase countsCurrent throttling statusPCIe correctable error countPercent free blocksCapacitor healthNUSE - Namespace utilizationPLP start countEndurance estimateLog page versionErrata Version FieldPoint Version FieldMinor Version FieldMajor Version FieldNVMe Base Errata VersionBoot SSD Spec Version%x.%x.%x.%xFirmware RevisionDSSD Spec Version0x%02X%02X%02X0x%04x%-40s : %-4s Log Page Headerskip generic_structure_parserReason Identifierstatus: %d Failed to open %s file. Current Throttling StatusTotal NUSEReserved4Critical WarningAvailable SpareAvailable Spare ThresholdPercentage UsedData Units ReadData Units WrittenController Busy TimePower CyclesUnsafe ShutdownsMajor VersionMinor VersionTelemetry Profile SelectedData Area 1 Statistic StartData Area 1 Statistic SizeData Area 2 Statistic StartData Area 2 Statistic SizeReserved5Event FIFO 1 Data AreaEvent FIFO 2 Data AreaEvent FIFO 3 Data AreaEvent FIFO 4 Data AreaEvent FIFO 5 Data AreaEvent FIFO 6 Data AreaEvent FIFO 7 Data AreaEvent FIFO 8 Data AreaEvent FIFO 9 Data AreaEvent FIFO 10 Data AreaEvent FIFO 11 Data AreaEvent FIFO 12 Data AreaEvent FIFO 13 Data AreaEvent FIFO 14 Data AreaEvent FIFO 15 Data AreaEvent FIFO 16 Data AreaEvent FIFO 1 StartEvent FIFO 1 SizeEvent FIFO 2 StartEvent FIFO 2 SizeEvent FIFO 3 StartEvent FIFO 3 SizeEvent FIFO 4 StartEvent FIFO 4 SizeEvent FIFO 5 StartEvent FIFO 5 SizeEvent FIFO 6 StartEvent FIFO 6 SizeEvent FIFO 7 StartEvent FIFO 7 SizeEvent FIFO 8 StartEvent FIFO 8 SizeEvent FIFO 9 StartEvent FIFO 9 SizeEvent FIFO 10 StartEvent FIFO 10 SizeEvent FIFO 11 StartEvent FIFO 11 SizeEvent FIFO 12 StartEvent FIFO 12 SizeEvent FIFO 13 StartEvent FIFO 13 SizeEvent FIFO 14 StartEvent FIFO 14 SizeEvent FIFO 15 StartEvent FIFO 15 SizeEvent FIFO 16 StartEvent FIFO 16 SizeReserved6Error IDFile IDLine NumberValid FlagsVU Reason ExtensionLogIdentifierIEEE OUI IdentifierGlobal Device Hardware RevisionUnsupported Requirement-C5 Log Page Data- Error Recovery/C1 Log Page Data Panic ID : 0x%x Log page GUID : 0x Device Capability/C4 Log Page Data PCI Express Ports : 0x%x OOB Management Support : 0x%x Write Zeroes Command Support : 0x%x Sanitize Command Support : 0x%x Dataset Management Command Support : 0x%x Write Uncorrectable Command Support : 0x%x Fused Operation Support : 0x%x Minimum Valid DSSD Power State : 0x%x DSSD Power State Descriptors : 0x Log Page Version : 0x%x TCG Configuration C7 Log Page Data- State : 0x%x Reserved1 : 0x Locking SP Activation Count : 0x%x Tper Revert Count : 0x%x Locking SP Revert Count : 0x%x Number of Locking Objects : 0x%x Number of Single User Mode Locking Objects : 0x%x Number of Range Provisioned Locking Objects : 0x%x Number of Namespace Provisioned Locking Objects : 0x%x Number of Read Locked Locking Objects : 0x%x Number of Write Locked Locking Objects : 0x%x Number of Read Unlocked Locking Objects : 0x%x Number of Write Unlocked Locking Objects : 0x%x Reserved2 : 0x%x SID Authentication Try Count : 0x%x SID Authentication Try Limit : 0x%x Programmatic TCG Reset Count : 0x%x Programmatic Reset Lock Count : 0x%x TCG Error Count : 0x%x Reserved3 : 0x Log Page Version : 0x%x Log page GUID : 0xIssue Set Feature command (FID : 0xC9) DSSD Async Event ConfigSet DSSD Asynchronous Event Configuration Successfully set the DSSD Asynchronous Event ConfigurationEnable Panic Notices bit Value: 0x%x Issue Get Feature command (FID : 0xC9) DSSD Async Event Configget-feature:0xC9 %s value: %#08x return set of enable IEEE1667 siloIEEE1667 Sifo Enabled (feature: 0x%02x): 0x%0x (%s: %s)Could not get feature: 0x%02x.Hardware Component Log Size: 0x%lx Additional Information Size: 0x%lx Manufacture Code: 0x%016lx -Latency Monitor/C3 Log Page Data- Feature Status 0x%x Active Bucket Timer %d min Active Bucket Timer Threshold %d min Active Threshold A %d ms Active Threshold B %d ms Active Threshold C %d ms Active Threshold D %d ms Active Latency Configuration 0x%x Active Latency Minimum Window %d ms Active Latency Stamp Units %d Static Latency Stamp Units %d Debug Log Trigger Enable %d Debug Log Measured Latency %d Debug Log Latency Time Stamp N/A Debug Log Latency Time Stamp %s Debug Log Pointer %d Debug Counter Trigger Source %d Debug Log Stamp Units %d Log Page Version %d Log Page GUID %s Active Bucket Counter: Bucket %d %27d %27d %27d Active Latency Time Stamp: Bucket %d N/A Active Measured Latency: Bucket %d %27d ms %27d ms %27d ms Static Bucket Counter: Bucket %d %27d %27d %27d Static Latency Time Stamp: Bucket %d Static Measured Latency: Bucket %d %27d ms %27d ms %27d ms Log Page Version : 0x%x Reserved : Log page GUID : 0x Telemetry String Log Size : 0x%lx Statistics Identifier String Table Start : 0x%lx Statistics Identifier String Table Size : 0x%lx Event String Table Start : 0x%lx Event String Table Size : 0x%lx VU Event String Table Start : 0x%lx VU Event String Table Size : 0x%lx ASCII Table Start : 0x%lx ASCII Table Size : 0x%lx index value ascii_val Statistics Identifier String Table Vendor Specific Statistic Identifier : 0x%x Reserved : 0x%x ASCII ID Length : 0x%x ASCII ID offset : 0x%lx Event Identifier String Table Entry Debug Event Class : 0x%x Event Identifier : 0x%x ASCII ID Length : 0x%x ASCII ID offset : 0x%lx Reserved : 0x%x VU Event Identifier String Table Entry VU Event Identifier : 0x%x Byte Data_Byte ASCII_Character %lu %d %c Active Bucket Counter: Bucket %dActive Latency Time Stamp: Bucket %dActive Measured Latency: Bucket %dStatic Bucket Counter: Bucket %dStatic Latency Time Stamp: Bucket %dStatic Measured Latency: Bucket %dDataset Management Command SupportWrite Uncorrectable Command SupportMinimum Valid DSSD Power StateStatistics Identifier String Table StartVendor Specific Statistic IdentifierStatistics Identifier String Table %dStatistics Identifier String TableEvent Identifier String Table Entry %dEvent Identifier String Table EntryVU Event Identifier String Table Entry %dVU Event Identifier String Table EntryNumber of Single User Mode Locking ObjectsNumber of Range Provisioned Locking ObjectsNumber of Namespace Provisioned Locking ObjectsNumber of Read Locked Locking ObjectsNumber of Write Locked Locking ObjectsNumber of Read Unlocked Locking ObjectsNumber of Write Unlocked Locking ObjectsERROR: No OCP UUID index found Statistics Identifier : 0x%x, %s Statistics info : 0x%x NS info : 0x%x Statistic Data Size : 0x%x Failed to get C9 String. status: %d ============================================================================== Failed to parse Event FIFO. status:%d Retrieve telemetry string log formatERROR : OCP : Unable to read C9 data from buffer ERROR : OCP : Failure reading the C9 Log Page, ret = %d Retrieve TCG Configuration Log Page DataERROR : OCP : Unknown GUID in C7 Log Page data ERROR : OCP : Unable to read C7 data from buffer ERROR : OCP : Failure reading the C7 Log Page, ret = %d failed to allocate memory for opts: %s Expected %s argument for '%s' but got '%s'! DRAM corruption non-critical pathNumber of Error Injecttions (feature: %#0*x): %#0*x (%s: %d)Entry: %d, Flags: %x (%s%s), Type: %x (%s), NRTDP: %d Error injection data structure entriesNumber of valid error injection data entriesNumber of reads to trigger device panicset-error-injection, data: %s, number: %d, uuid: %d, type: %d, nrtdp: %d Physical media units written - %lu %lu Physical media units read - %lu %lu Bad user nand blocks - Raw %lu Bad user nand blocks - Normalized %d Bad system nand blocks - Raw %lu Bad system nand blocks - Normalized %d Uncorrectable read error count %lu Soft ecc error count %lu End to end detected errors %u End to end corrected errors %u System data percent used %d Max User data erase counts %u Min User data erase counts %u Number of Thermal throttling events %d Current throttling status 0x%x PCIe correctable error count %lu NVMe base errata version %c NVMe command set errata version %c Security Version Number %lu NUSE - Namespace utilization %lu NVMe Command Set Errata Version %d Lowest Permitted Firmware Revision %lu Errata Version Field %d Point Version Field %u Minor Version Field %u Major Version Field %d NVMe Base Errata Version %d PCIe Link Retraining Count %lu Power State Change Count %lu Bad user nand blocks - NormalizedBad system nand blocks - NormalizedUncorrectable read error countNumber of Thermal throttling eventsNVMe Command Set Errata VersionLowest Permitted Firmware RevisionTelemetry Host-Initiated Data Block 1SMART / Health Information Log(LID-02h)SMART / Health Information Extended(LID-C0h)==============================================================================Bad User NAND Blocks Raw CountBad User NAND Blocks Normalized ValueBad System NAND Blocks Raw CountBad System NAND Blocks Normalized ValueEnd to End Correction Counts Detected ErrorsEnd to End Correction Counts Corrected ErrorsNumber of thermal throttling eventsMedia and Data Integrity ErrorsNumber of Error Information Log EntriesWarning Composite Temperature TimeCritical Composite Temperature TimeThermal Management Temperature 1 Transition CountThermal Management Temperature 2 Transition CountTotal Time for Thermal Management Temperature 1Total Time for Thermal Management Temperature 2Number Telemetry Profiles SupportedTelemetry Host-Initiated Data Area 1 Last BlockTelemetry Host-Initiated Data Area 2 Last BlockTelemetry Host-Initiated Data Area 3 Last BlockTelemetry Host-Initiated Data Area 4 Last BlockTelemetry Controller-Initiated ScopeTelemetry Controller-Initiated Data AvailableTelemetry Controller-Initiated Data Generation NumberTelemetry Host-Initiated ScopeTelemetry Host Initiated Generation NumberTelemetry Host-Initiated Data AvailableЎ 0@X|\D` pHK xhXH8(69x9(9868P8866666667ocp_clear_featureenable_ieee1667_silo_geterror_injection_seterror_injection_get@$~GT*Tget_c7_log_pageget_dssd_async_event_configset_dssd_async_event_configO@BEntry Id: 0x%x Failed to open %sasicnanddrampmicpcbcasecountryhw-revcomp-idcomponent identifierlist component descriptionsid: %02Xh version: %04Xh size: %s error: ocp: calloc: %s ERROR: %s: fsync: %s %s: FAILURE: %s: INFO: reason_idcorrectedminimumphysical_media_units_writtenphysical_media_units_readbad_user_nand_blocksbad_system_nand_blockse2e_correction_countssystem_data_percent_usedrefresh_countsuser_data_erase_countsthermal_statusdssd_specific_verpcie_correctable_error_countincomplete_shutdownspercent_free_blocksnvme_base_errata_versionnvme_cmd_set_errata_versionnvme_errata_versionsecurity_version_numbertotal_nuseplp_start_countpcie_link_retraining_countpower_state_change_countlowest_permitted_fw_revhardware_revisionlog_page_versioncurrent_statusnum_eventsmajor_verminor_verpoint_vererrata_verInvalid output format '%s' Solidigm SMART log%#x %-45s %3d min: %u, max: %u, avg: %u %u%%, cnt: %u -qALL|CIT|HIT|NLOG|ASSERT|EVENTLog type; Defaults to ALL.To print out verbose info.HITCITNLOGInvalid log type: %s -%Y%m%d%H%M%Smkdir%s/NLog.binVersion Major %u Version Minor %u Log_select %u totalnlogs %u nlognum %u nlogname %c%c%c%c nlogbytesize %u nlogprimarybuffsize %u tickspersecond %u corecount %u nlogpausestatus %lu selectoffsetref %u selectnlogpause %u selectaddedoffset %u nlogbufnum %u nlogbufnummax %u coreselected %u Error retrieving Nlog%.*s/%score %d assert size: %d Error retrieving Assert log%s/EventLog.bincore: %d event: %d validity: %d offset: %d Error retrieving Event logId Active Namespace ID listId NVM Set ListId I/O Command Set specificId Controller ListId Namespace dataAllocated Namespace DataOCP TCG ConfigurationTempeture StatisticsLatency Outlier%s.zipCompressing logs to %s rm -rf %sFailed removing logs folderTotal: %d log files in %s/%s timer_typeTimestamp Timer Type%-13lu %d Enable Latency TrackingDisable Latency TrackingGet read statisticsGet write statisticsLog type to getInvalid Log type value '%d' average_latencyconfig-fileJSON configuration filesource-fileParse Solidigm Telemetry logidentify_ctrl: %s get-telemetry-log: %s Telemetry log too short. telemetryHeaderlogIdentifierieeeOuiIdentifierdataArea1LastBlockdataArea2LastBlockdataArea3LastBlockhostInitiatedDataGenerationreasonIdentifierversionMajorversionMinorreasonCodedriveStatusfirmwareVersionbootloaderVersionserialNumberoemDataMapOffsettelemetryMajorVersiontelemetryMinorVersionproductFamilyIdreserved2dualPortReservedcodtableOfContentstelemetryObjectsNLOG_FORMATSdataAreadataAreaIndexdataAreaOffsetfileOffsettelemMajortelemMinorobjectIdmediaBankIdTELEMETRY_OBJECT_UIDSUID_NLOG_objectDatahasTelemObjHdrobjName0x%08X output format : normal | jsonOCP Error RecoveryOCP Device CapabilitiesOCP Unsupported Requirementsuuidx%-5s %-4s %-42s %-.5s %-.4s %-.42s %-5d 0x%02x %s %s: %d |tracker enabletracker disablesample-timeSample intervalTracker typeflush-freqwall-clocktrigger-fieldField name to stop trigger ontrigger-thresholdtrigger-on-deltatrigger-on-latencytracker set-feature: %sSleeping %lluus.. Tracker disabledParse %s [%c%.*s] %3d%% %s [%.*s%c%.*s] %3d%% %s [%.*s] %3d%% Array_NameVolume_NameVolume_IDAccess_Stateopen%s is not a valid number %d%s%-11d %-11s %-11s %-11u %-*lu ../nvme-print-json.cdefault10s30s1m5m10m30m1hMedia Read CountHost Read countMedia Write CountHost Write CountDevice ModelMinimum TemperatureMaximum TemperaturePower Loss Protection StatusLifetime Power Cycle CountMinimum Read LatencyMaximum Read LatencyAverage Read LatencyMinimum Write LatencyMaximum Write LatencyAverage Write LatencyGrown Defects CountDQS Recovery CountTotal Defrag Writes CountMax Die Offline NumberCurrent Die Offline NumberXOR Enable StatusMedia Life UsedUncorrectable Error CountCurrent Wear Range DeltaRead Errors Corrected by XORBackground Data RefreshPmic Vin History Data 1 MinPmic Vin History Data 1 MaxPmic Vin History Data 1 AvgPmic Vin History Data 2 MinPmic Vin History Data 2 MaxPmic Vin History Data 2 AvgMedia Wear RemainingTotal Non-Defrag WritesMedia Health Relocationsunthrottledfirst_levelsecond_levelthird_levelERROR: WDC: Unable to get 0x%x Log Page length with uuid %d, ret = 0x%x ERROR: WDC: Unable to read 0x%x Log Page data with uuid %d, ret = 0x%x ERROR: WDC - %s: Buffer is not large enough for the common header. BufSize: 0x%x HdrSize: %lx ERROR: WDC: %s: Detected unaligned end of the data. Data Offset: 0x%x Entry Size: 0x%x, Remaining Log Length: 0x%x Entry Id: 0x%x ERROR: WDC: %s: Invalid entry found at offset: 0x%x Entry Size: 0x%x, Remaining Log Length: 0x%x ERROR: WDC: C2 log id 0x%x not found with uuid index %d lid_0x%02x_lsp_0x00_lsi_0x0000.bin Failed to allocate %ld bytes! Failed to read %ld bytes from %sCould not get feature: 0xC7 with sel: %d get-feature:0xC7 %s value: %#08x retrieve hardware component logerror: ocp: invalid output format error: ocp: failed to get log simple (hwcomp: %02X, ret: %d) error: ocp: failed to get log page (hwcomp: %02X, ret: %d) error: ocp: failed get hwcomp log: %02X data, ret: %d error: ocp: failed to get hwcomp log: %02X, ret: %d Telemetry Host-Initiated and Telemetry Controller-Initiated log pages not supported %s: Controller initiated option telemetry log page disabled ERROR: WDC: Get telemetry option feature failed.%s: Invalid type parameter; type = %d %s: Failed to acquire telemetry header! ERROR: WDC: reading dump length failed INFO: WDC: Capture Diagnostics log is empty %s: INFO: data_len 0x%x not 4 byte aligned. %s: INFO: Round down to 0x%x. %s: Partial data may have been captured INFO: WDC: Capture Diagnostics log, length = 0x%x Not found, requesting log page with uuid_index %d ERROR: WDC: VUReadSize() failed, ERROR: WDC: Unknown GUID in C0 Log Page data SMART Cloud Attributes for NVMe device : %s Physical Media Units Written : %'.0Lf Physical Media Units Read : %'.0Lf Bad User NAND Blocks (Normalized) : %u%% Bad User NAND Blocks (Raw) : %lu Bad System NAND Blocks (Normalized) : %u%% Bad System NAND Blocks (Raw) : %lu XOR Recovery Count : %lu Uncorrectable Read Error Count : %lu Soft ECC Error Count : %lu End to End Correction Counts (Corrected) : %u End to End Correction Counts (Detected) : %u System Data %% Used : %u%% Refresh Counts : %lu User Data Erase Counts (Minimum) : %u User Data Erase Counts (Maximum) : %u Thermal Throttling Status (Current Status) : %s Thermal Throttling Status (Number of Events) : %u NVMe Major Version : %u Minor Version : %u Point Version : %u Errata Version : %u PCIe Correctable Error Count : %lu Incomplete Shutdowns : %u %% Free Blocks : %u%% Capacitor Health : %u%% NVMe Base Errata Version : %c NVMe Command Set Errata Version : %c NVMe Errata Version : %c Unaligned IO : %lu Security Version Number : %lu Total NUSE : %lu PLP Start Count : %'.0Lf Endurance Estimate : %'.0Lf PCIe Link Retraining Count : %lu Power State Change Count : %lu Lowest Permitted FW Revision : %-.*s Hardware Revision : %s Log Page Version : %u Log Page GUID : %s uncorrectable_read_error_countERROR: WDC: Unable to read C0 Log Page data ERROR: WDC: Unknown GUID in HW Revision Log Page data Get Solidigm vendor specific smart log (optionally, for the specified namespace), and show it.Additional Smart Log for NVMe device:%s namespace-id:%x UUID-idx:%d Retrieve the extended SMART health data.ERROR : OCP : Unknown GUID in C0 Log Page data ERROR : OCP : Expected GUID: 0x ERROR : OCP : Actual GUID: 0xERROR : OCP : Unable to read C0 data from buffer ERROR : OCP : Failure reading the C0 Log Page, ret = %d Output directory; defaults to current working directory.Get Debug Firmware Logs and save them.Error retrieving Host Initiated TelemetrySuccessfully wrote Nlog to %s Error retrieving Controller Initiated TelemetryAssert Log, cores: %d log size: %d header size: %d Successfully wrote Assert to %s Event Log, cores: %d log size: %d Successfully wrote Events to %s Id Allocated Namespace ID listId Namespace Id Descriptor listId Namespace ID I/O Command Set specificI/O Command Set Independent Identify Namespace DataId Namespace Id Controller Listlid_0x0d_lsp_0x00_lsi_0x0000.binError retrieving Persistent Event Log pageOCP or VU SMART / Health Information ExtendedOCP Error Recovery or VU Latency ReadsOCP Firmware Activation History or VU Latency WritesOCP Device Capabilities or VU Endurance Manager StatisticsOCP Unsupported Requirements or VU Tempeture Statisticscd "%s" && zip -MM -r "../%s" ./* %sCan't allocate string for zip commandCan't allocate string for cleanupGet and parse Solidigm vendor specific garbage collection event log.Solidigm Garbage Collection Log for NVME device:%s UUID-idx:%d Get Solidigm Marketing Name log and show it.Solidigm Marketing Name Log: %s Get and Parse Solidigm Latency Tracking Statistics log.Log type option valid only when retrieving statistics Cannot enable and disable simultaneously. Successfully set enable bit for UUID-idx:%d FID:0x%X, to %i. Cannot capture read and write logs simultaneously. Latency Statistics Tracking (UUID-idx:%d, FID:0x%X) is currently %i. Could not read feature id 0xE2. Controls when to generate new host initiated report. Default value '1' generates new host initiated report, value '0' causes retrieval of existing log.data source is binary file containing log dump instead of block or character deviceInvalid host-generate value '%d' Failed to open JSON configuration file %s: %s! Parsing error on JSON configuration file %s: %s (at offset %d) Failed to acquire identify ctrl %d! controllerInitiatedDataAvailablecontrollerInitiatedDataGenerationWarning: COD map header out of bounds. Warning: Unsupported COD data signature %x! Warning: COD map data out of bounds. Warning: COD data out of bounds at item %lu! Warning: Unknown COD field type (%d) Warning: Data Area %d don't fit this Telemetry log. Warning: Data Area %d, Table of Contents item %d crossed Data Area size. Warning: Data Area %d, item %d data, crossed Data Area size. %s:%d do not fit this log dump. %s:%d with %d header mismatches ( %s). Configuration file may be missing format headers. Retrieves the OCP firmware activation history log.Error: Unexpected data. Log page guid does not match with expected. Error: Invalid output format. Retrieves list of supported log pages for each UUID index.OCP Firmware Activation HistoryError: Invalid output format specified: %s. Get/show Temperature Statistics log.Error: Log page has OCP unsupported Requirements GUID solidigm-vs-drive-info: drive missing namespacesolidigm-vs-drive-info: performance options not availableLimit runtime capture time in secondsSamples (1 to 126) to wait for extracting data. Default 100 samplesLogs current wall timestamp when entry was retrievedField value to trigger stop samplingTrigger on delta to stop samplingUse latency tracker to trigger stop samplingReal Time capture Workload Tracker samplesInvalid number of samples: %s. Valid values: 1-%dInvalid field name: %s. For type: "%s", valid fields are: %sTrigger Threshold set-feature: %sCan't enable disable simultaneouslyInvalid tracker type: "%s". Valid types: %sinvalid Sample interval: %s. Valid values: %sNo enough parameters. abort...failed on cmd.data_len %u cmd.cdw13 %u cmd.cdw12 %x cmd.cdw10 %u err %x remaining size %d Lifetime Unsafe Shutdown CountDefrag Writes in Progress CountPmic Vin History Data Total ReadingsAll Time Current Max Wear LevelZUd_jsongetlogpage================================================== sldgm_get_workload_trackersldgm_get_temp_stats_log----------------------------------------------------------------------------------------------------XnCeAsolidigm_get_log_page_directory_logmyvMocp_fw_activation_history_logsolidigm_get_telemetry_logsolidigm_get_latency_tracking_logsldgm_get_market_logsolidigm_get_garbage_collection_logilog_dump_log_pageilog_dump_pelilog_dump_event_logsilog_dump_assert_logsilog_dump_nlogssolidigm_get_internal_logocp_smart_add_logsolidigm_get_additional_smart_log^H<ů(Oo|կnvme_get_print_ocp_cloud_smart_logwdc_get_drive_reason_idwdc_de_VU_read_sizewdc_get_max_transfer_lenwdc_get_dev_mng_log_entryget_dev_mgmt_log_page_lid_data""""""""-R LZ3)pwdc_do_cap_telemetry_logwdc_do_dump_e6wdc_do_cap_diagget_hwcomp_log_dataget_dssd_power_stateget_telemetry_data./%s%.2Lf %sBdump binary vendor fieldAdmincommand flagsprefillrsvdvalue for reserved fieldmetadata-lenmetadata seg. length (bytes)cdw2command dword 2 valuecdw3command dword 3 valuecommand dword 10 valuecommand dword 11 valuecommand dword 12 valuecdw13command dword 13 valuecdw14command dword 14 valuecdw15command dword 15 valuemetadata input or output fileprint command before sendingdata direction not given%s failed with error = 0x%x memory alloc failed for %s LockedUnlockedmsgfilemsgtargetprogram-keyread-counterwrite-configread-configFailed to read key Failed to read file %s Write Counter is: %u failed read config blk Boot Partition 1 is %s Boot Partition 0 is %s read_request failed Writing %d bytes to file %s invalid transfer size %d hmac(sha256)Failed to write-dataFailed to Program Keyinvalid transfer size %d taskTASK[register|deregister]Invalid --task: %s Did not find device %s: %s dhchap-ctrl-secretScan current NVMeoF topologymodifyupdatenvme device handleFailed to disconnect %s: %s Did not find device %s loopalready connected Invalid input arguments.%Y-%m-%dD|%H:%M:%S%s:%03ldStatistics IdentifierStatistic Identifier StringStatistics Info Behavior TypeStatistics Info ReservedNamespace Information ValidStatistic Data SizeStatistic Specific DataoffsetBitsizeBitenummemberListarraySize%5u%u:%u:%u%16lu%2ufail #%d%16uPower on HourPrevious FirmwareNew Firmware/usr/local/nvmecli Serial Number: %-.*s Log page GUID 0x../ccan/ccan/strset/strset.cbit_num < CHAR_BITentry_is_valid((uintptr_t)p)hardware-component-logget-enable-ieee1667-siloset-error-injectionget-error-injectiontcg-configuration-logget-dssd-async-event-configGet DSSD Async Event Configset-dssd-async-event-configSet DSSD Async Event Configset-telemetry-profileSet Telemetry Profile Featuretelemetry-string-logget-plp-health-check-intervalGet PLP Health Check Intervalset-plp-health-check-intervalSet PLP Health Check Intervalget-dssd-power-state-featureGet DSSD Power State featureset-dssd-power-state-featureSet DSSD Power State featuredevice-capability-logclear-pcie-correctable-errorseol-plp-failure-modeclear-fw-activate-historyset-latency-monitor-featureSet Latency Monitor featureGet Latency Monitor Log PagepasswordunlockUnlock a SED Opal DeviceLock a SED Opal Deviceinitializesmart-log-addzrwa-flush-zoneoffline-zoneOffline one or more zonesopen-zoneOpen one or more zonesfinish-zoneFinish one or more zonesclose-zoneClose one or more zonesreset-zoneReset one or more zonesvs-device-wafvs-hw-rev-logvs-cloud-logWDC Get the Cloud Log Pagecloud-boot-SSD-versionget-unsupported-reqs-logget-dev-capabilities-logget-error-recovery-logget-latency-monitor-logvs-pcie-statsWDC VS PCIE Statisticscloud-SSD-plugin-versionWDC Cloud SSD Plugin VersionWDC Device Capabilitiesvs-temperature-statsWDC Get Temperature Statsvs-drive-infoWDC Get Drive Infonamespace-resizeWDC NamespaceDrive Resizelog-page-directoryWDC Get Log Page Directoryvs-error-reason-identifierenc-get-logWDC Get Enclosure LogWDC Clear FW Activate Historyvs-fw-activate-historyWDC Get FW Activate Historydrive-resizeWDC Drive Resizeclear-assert-dumpWDC Clear Assert Dumpget-drive-statusWDC Get Drive Statusdrive-essentialsWDC Drive Essentialsvs-smart-add-logWDC Additional Smart Logvs-nand-statsWDC NAND StatisticsWDC Internal Firmware Logpurge-monitorWDC Purge MonitorpurgeWDC PurgeWDC identify controllerget-pfail-dumpWDC Pfail Dumpget-crash-dumpWDC Crash Dumpdrive-logWDC Drive Logcap-diagWDC Capture-Diagnosticsshow-identifysave-smart-to-vtview-logbadblockGet NVME bad block numberhealthvalueNVME health percentageGet Internal LogExtended SMART informationworkload-trackercloud-SSDplugin-versionPrints plug-in OCP versionRetrieve drive informationtemp-statsRetrieve log page directoryparse-telemetry-logParse Telemetry Log binarylatency-tracking-logmarket-logRetrieve Market Loggarbage-collect-logRetrieve Debug log binariesRetrieve Solidigm SMART Logget-additional-featureset-additioal-featureget-ctrl-teleget-host-televs-log-page-supexpand-capdump-evtlogGet a featureSet a featureDynamic change capacityQuery current capacity infolat-statsontapdevicesNetApp ONTAPdevicessmdevicesNetApp SMdevicesshowvs-smbus-optionRetrieve extended SMART datalatency-logslatency-statslatency-trackingDisplay FW activation historyDisplay plugin version infoRetrieve Drive informationvs-smart-ext-logRetrieve extended SMART logsRetrieve NAND StatsRetrieve Micron logsClear correctable PCIe errorsselect-downloadSelective Firmware Downloadperf-stats-print-xlat-log-print-xlat-stats-print-xlat-get-feature-xlat-set-feature-xsmart-log-add-xclear-error-logClear error loglat-log-printSet Memblaze High Latency Loglat-stats-printset-pm-statusget-pm-statusmarket-namelat-stats-trackingset-bucket-thresholdsnvme-vendor-logget-cdumpget cdump dataget-eventlogget event logHuawei identify controllerset-eventsEnabled or disable eventsUpdate a reclaim unit handleShow statisticsusageList configurationsocpOCP cloud SSD extensions2.9.2SED Opal Command SetssstcznsZoned Namespace Command Setymtcwdc2.11.1virtiumtranscendtoshibaToshiba NVME pluginsolidigm1.8shannonseagatesfxnvidianetappACPI NBFT table extensionsmicronmemblazeintelinspurinnogrithuaweifdpderadelldapustoramznSend an Identify Controller command to the given device and report information about the specified controller in human-readable or binary format. May also return vendor-specific controller attributes in hex-dump if requested.prefill buffers with known byte-value, default 0set dataflow direction to receiveset dataflow direction to sendfailed to read metadata write buffer%s Command %s latency: %llu us %s Command %s is Success and result: 0x%08x failed to write metadata bufferRPMB request 0x%04x to target 0x%xerror 0x%x receiving response for %s RPMB action - info, program-key, read-counter, write-data, read-data, write-config and read-configdata file for read/write-data, read/write-config optionskey file that has authentication key to be usedkey to be used for authenticationdata to be written on write-data or write-config commandsSector offset to read from or write to for an RPMB target, default 0Number of 512 blocks to read or writeRPMB target - numerical value of 0 to 6, default 0Run RPMB command on the supporting controllerNo RPMB targets are supported by the drive Invalid option %s for rpmb command Invalid key size %d, valid input 1 to 223 Boot Partition Protection is %s Saving received config data to %s file Failed to allocated memory for read-data req Failed to read write counter for write-data Memory alloc failed for write-data command failed to compute HMAC-SHA256 RPMB request 0x%04x for 0x%x, error: %d Write-data read result 0x%x, error = 0x%x Auth data write recv error = 0x%x Written %d sectors out of %d @target(%d):0x%x failed to allocate rpmb request buffer failed to read config block write counter failed to compute hmac-sha256 hash Write-config RPMB request, error = 0x%x failed to allocate response buffer memory Failed getting write-config response error = 0x%x Failed to retrieve write-config responsefailed to allocate request buffer memory RPMB request 0x%04x for 0x%x, err: %d Program auth key read result 0x%x, error = 0x%x Comma-separated list of DC nqnComma-separated list of DC nvme device handle.Send Discovery Information Management command to a Discovery Controller (DC)Neither device name [--device | -d] nor NQN [--nqn | -n] provided Task [--task | -t] must be specified user-defined dhchap controller key (for bi-directional authentication)Modify JSON configuration fileDump JSON configuration to stdoutUpdate JSON configuration filerequired argument [--nqn | -n] needed with --modify required argument [--transport | -t] needed with --modify Failed to lookup host '%s': %s Failed to lookup subsystem '%s': %s Failed to lookup controller: %s NQN:%s disconnected %d controller(s) required argument [--nqn | -n] not specified required argument [--transport | -t] not specified required argument [--traddr | -a] not specified for transport %s could not add new controller: %s Warning: Structure definition missing property 'name': %s Warning: Structure definition missing property 'offsetBit': %s Warning: Structure definition missing property 'sizeBit': %s Warning: Structure definition missing property 'arraySize': %s Warning: Structure property 'arraySize' don't support flexible array: %s Warning: Structure property 'arraySize' don't support more than %d dimensions: %s Warning: %s From property '%s', array index %u, structure definition: %s ERROR: WDC: Invalid buffer to read fw activate history entries Firmware Activate History Log Power on Hour Power Cycle Previous New Entry hh:mm:ss Count Firmware Firmware Slot Action Result ----- ----------------- ----------------- --------- --------- ----- ------ ------- Power Cycle Previous New Entry Timestamp Count Firmware Firmware Slot Action Result Power on Hour Power Cycle Previous New Entry hh:mm:ss Count Firmware Firmware Slot Action Result ----- -------------- -------------------- ---------- ---------- ----- ------ -------ERROR: WDC: Invalid buffer to read 0xC0 V1 log Latency Monitor/C3 Log Page Data Active Latency Config 0x%x ERROR: WDC: latency monitor read id ctrl failure, err = %d Debug Telemetry Log Size %lu Read Write Deallocate/TrimRetrieve TCG Configuration Log PageRetrieve Telemetry string Log PageGet Device capabilities Requirements Log PageRetrieve Error Recovery Log PageGet Unsupported Requirements Log PageGet firmware activation history logClear PCIe correctable error countersDefine EOL or PLP circuitry failure mode.Clear firmware update history logRetrieve and save internal device telemetry logRetrieve extended SMART InformationChange the SED Opal Device passwordRevert a SED Opal Device from lockingInitialize a SED Opal Device for lockingDiscover SED Opal Locking FeaturesRetrieve ssstc SMART Log, show itAppend data and metadata (if applicable) to a zoneSend the zone management send commandSend the zone management receive commandRetrieve the changed zone list logFlush LBAs associated with a ZRWA to a zone.Attach zone descriptor extension data to a zoneReport zones associated to a Zoned NamespaceSend NVMe Identify Zoned Namespace Namespace, display structureSend NVMe Identify Zoned Namespace Controller, display structureList all NVMe devices with Zoned Namespace Command Set supportRetrieve Ymtc SMART Log, show itWDC set Latency Monitor featureWDC Calculate Device Write Amplication FactorWDC Get the Hardware Revision Log PageWDC Get the Cloud Boot SSD VersionWDC Get Unsupported Requirements Log PageWDC Get Device Capabilities Log PageWDC Get Error Recovery Log PageWDC Get Latency Monitor Log PageWDC Telemetry Reason Identifiervs-telemetry-controller-optionWDC Enable/Disable Controller Initiated Telemetry LogWDC Clear PCIe Correctable Error CountShows detail features and current settingsPeriodically save smart attributes into a log file. The data in this log file can be analyzed using excel or using Virtium’s vtView. Visit vtView.virtium.com to see full potential uses of the dataClear PCIe correctable error countRetrieve Temperature Statistics logGet firmware activation history log (redirects to ocp plug-in)Clear firmware update history log (redirects to ocp plug-in)clear-pcie-correctable-errors Clear PCIe Correctable Error Counters (redirects to ocp plug-in)Enable/Retrieve Latency tracking LogRetrieve Garbage Collection LogGet SMART / health extended log (redirects to ocp plug-in)Retrieve Shannon ctrl id, show itGet additional Shannon featureSet additional Shannon featureRetrieve Shannon SMART Log, show itShows OCP Seagate plugin's version information Shows Seagate plugin's version information Clear Firmware Activation HistoryRetrieve the Firmware Activation HistoryRetrieve Seagate Controller-Initiated Telemetry in binary formatRetrieve Seagate Controller-Initiated Telemetry Retrieve Seagate Host-Initiated Telemetry Clear Seagate PCIe error statistics Retrieve Seagate PCIe error statistics Retrieve Seagate extended-SMART Information Retrieve Seagate Supported Log-pages Information Retrieve Seagate temperature statistics expand the last namespace capacity losslessdump evtlog into file and parse warning & error logRetrieve bad block table of block device, show itRetrieve ScaleFlux IO Latency Statistics log, show itRetrieve ScaleFlux SMART Log, show itShow contents of ACPI NBFT tablesEnable/Disable SMBUS on the driveLatency log details tracked by driveLatency information for tracked commandsLatency monitoring feature controlEnable/Disable controller telemetry log generationRetrieve Micron PCIe error statsRetrieve Micron temperature statistics Get Performance Stat log and show it.Get High Latency log and show it.Get Enabled/Disabled of Latency Monitor featureSet Enable/Disable for Latency Monitor featureRetrieve Memblaze SMART Log, show itOutput Memblaze High Latency LogRetrieve IO Latency Statistics log, show itEnable and disable Latency Statistics loggingSet Memblaze Power Manager StatusGet Memblaze Power Manager StatusRetrieve Intel Temperature Statistics log, show itRetrieve Intel SMART Log, show itRetrieve Intel Marketing Name log, show itEnable and disable Latency Statistics logging.Set Latency Stats Bucket Values, save itRetrieve Intel IO Latency Statistics log, show itRetrieve Intel internal firmware log, save itRetrieve Inspur Vendor Log, show itList all Huawei NVMe devices and namespaces on machineShow reclaim unit handle statusList events affecting reclaim units and media usageShow reclaim unit handle usageRetrieve Dera SMART Log, show itRetrieve DapuStor SMART Log, show itSSSTC vendor specific extensionsYmtc vendor specific extensionsWestern Digital vendor specific extensionsVirtium vendor specific extensionsTranscend vendor specific extensionsSolidigm vendor specific extensionsShannon vendor specific extensionsSeagate vendor specific extensionsScaleFlux vendor specific extensionsNVIDIA vendor specific extensionsNetApp vendor specific extensionsMicron vendor specific extensionsMemblaze vendor specific extensionsIntel vendor specific extensionsInspur vendor specific extensionsinnogrit vendor specific extensionsHuawei vendor specific extensionsManage Flexible Data Placement enabled devicesDera vendor specific extensionsDELL vendor specific extensionsDapuStor vendor specific extensionsAmazon vendor specific extensions@htable_add_    strset_addwdc_print_latency_monitor_log_normalwdc_clear_reason_idsldgm_get_uuid_indexrpmb_cmd_optionpassthruH;@- V-@!f-"-\&C.&V.l'.'.`(/(L/@)c/)/$*/* 0*D0d+|0+0T,0,(1@-]1-1 .1./2.g2X/2/2 030E30}3l1313<2"42Z434x3434T454p5p5555D65666J6h7676@868 79-7|9[797<:7:7:7<;8;C8<\8t<{8<8d=8=9$>)9t>@9>W9?n9?9`@9@90A:A6:TBM:Bd:F:G:K:$L:L';@MH;M_;Mv;DN;N;N;tO|S>S?dT"?U^?U @ Vj@X@tBBBBTB$BBԙBC-CFCT]CvC CtCԟC0CCDLD6DFDlWD$iDyDDHDtDDDD2EE EEEH F!F8FLHFZFF $G AG xG G GH HHHIJ K K| M pOd!P!@X8"Yt"Z"P[#^t#pb#`gT$h$Pi$0j,%Pmx%n%n&&&@'' ((p(d))H*p*++p,|,@,@d-p-H.@./ x/p/`@000$ 10)1-23\282=43A30F3PLx4pL4L4 _5`,5@c5Pc5Pg6kd6@o6s7y77`8`8@99@:`\:: ;PX;p;`;8<< ==@=@> >>0?d???,@|@ @TA@A0 BxBB(C)0Cp*hC+C,Cp- D/XD1D@2D6 E08XE`:E:E;,F;@F;TF;hFXA\YpBpYCY`HZH0ZH\ZIpZIZKZM4[M|[PN[N[Q,\Qh\`R\@T\W0]X|]X]Y]Z]k^k^l^pH_r_`v_@w `w(`~`Ёapa >40@`Bؿ0C0DhJLTPV W@Wd`h 0Dx@0Pt` PPT  d@l``0@x $0$p+@794?`BD II(LlNU0\@pdde ` P8L  0PмXp@08h0DP`$lp  Tp/7`9B,DlJOftl m nvd0wyp{ |8@}tP~,X` 0d@<`\8pp@Lh@``,XPD|(llp`pt4pp@"$$( $<''(,D`1<==>@@>h>>D4`L0OP$RXUhl nXol ooPqrH tP4p`0XP`ph00h`0h`@XPP4p ` |p0@ @P t X@4@8X@:PE0_Tb@i 0mhp}@xPPP@\ p0Ѝl0P0l P    0 L  p ( зx p l  PD    4xP0 DXp(@(()/X14<zRx @*&D$4FJ w?:*3$"\t**H^@*BEA D(G8K@Q8A0o (D ABBH zPLRxa L$\+BEE E(A0A8G`O 8D0A(B BBBJ tl `L,BEE E(A0A8GPQ 8D0A(B BBBH  PX.BEG A(G0i (D ABBH ] (A AEBJ L(A AHBPhH." BFB E(A0A8G; 8D0A(B BBBH J c869FBB A(DP~ (A BBBD `7XFBB B(A0A8G I  f!H D g 8A0A(B BBBH @L8oFDA l(C0\(A F ABH ACBT,8HBEE E(D0G8J`S 8A0A(B BBBE DhLpThB`|$;BBB E(D0D8GhHKAU 8A0A(B BBBK gHVBqHKA\ht>BBB E(D0D8I 8A0A(B BBBG  J^AHC%FBI B(A0A8D` 8D0A(B BBBG @CFEE A(D0G@l 0A(A BBBH DXdDFGA D0U8A@Y8A0T  ABBE I 8G@P HDFEE E(A0D8D` 8D0A(B BBBF TGFEE E(G0N@M 0A(B BBBH W0A(B BBB4D(H|JDN | AAF OF PpHh1EC h. B .e....H..Z. ezW P(hyGFQE B(A0H8G7 8D0A(B BBBF |g-l|AEd G LP }pFJP B(A0A8NZ 8D0A(B BBBG $8AP<FMI B(A0A8N 8D0A(B BBBE 2P) FMI B(A0A8N 8D0A(B BBBG XSyH,deFJI A(A0N 0D(A BBBD x;9GAHt"/FJP A(A0N, 0D(A BBBI H 4CFMI A(H0N 0D(A BBBC X 9AL|  FBB B(A0G L%R 0D(B BBBB p8%@ pFMI A(G (D BBBF 4 @8qA@X YFMI A(G (D BBBF 8DAH Щ,FMI A(A0N( 0D(A BBBA 8AP0 @FJI B(A0A8Nc 8D0A(B BBBE 2P h&FNL B(A0A8N 8D0A(B BBBD $ RHAP$ FJI B(A0A8Nc 8D0A(B BBBE x 2H DsFMI B(A0G 0D(B BBBI 5l@ 0PFMI A(G (D BBBF P 9:APt "FMI B(A0A8N9 8D0A(B BBBD $ nEAP 0FJI B(A0A8N 8D0A(B BBBA D7T8hxFJH G/  DBBJ +8A8FJH G/  DBBJ 7@ FMM A(G| (D BBBB d;@FMM A(G (D BBBF ;HFJI A(A0N  0D(A BBBH 41 HXxPdFJP A(A0N9 0D(A BBBD A8GAHX/FMP A(A0N 0D(A BBBI  8AH8FMP A(A0N 0D(A BBBI 8A8FJH GB  DBBG 5@\%FMI A(GJ (D BBBH Hz8AHl$FJI A(H0N& 0D(A BBBG B'b@t %FFJI A(G (D BBBF  70@@@EFMH A(Q (D ABBH T,BBB B(A0A8G L% 8D0A(B BBBG z?%PHFMI B(A0A8Ni 8D0A(B BBBD [*@*(FQA H(G/ (D ABBA "- @L-mFMO A(Nk (D ABBK .Q8@1=FMH Gy  DBBE t.)8 4+FJH G  DBBE HF.8hx8FJH N  DBBE .H<0FJP A(A0N* 0D(A BBBK AH4|AFMP A(A0N+ 0D(A BBBG 5@ GwFLK H(N2 (D ABBB x*nHHLZFMI A(H0N 0D(A BBBF T6"NHxQ2FMP A(A0N 0D(A BBBB !68W FJH N  DBBE $.@Dl\(FJH A(N; (D ABBE s288aFMH G  DBBB I+A8d3FMH G  DBBB @.0`hyoFMN EBD P0k)<FJN3 EBH n3Hj@oFMO A(N (D ABBF \X/A8r}AJ BS} C 0.N. ' 8uqFJH G  DBBD pP<D{ XFMM B(A0H8N " 8D0A(B BBBH 1: T FBB B(A0A8G L(v 8A0A(B BBBG $ @GA(@4 FJH A(N (D ABBC x0HqFMN{ EBE 0xQFMNw EBA n08QZFMNw EBA lt;0P'FNP DBF ; 0BAD G@~  DABE 8 T%FML G9  DBBI H04 (BEA GPc  DBBF 4h BEG T BBJ dHB0'FLNf DBD  P$ |FKB I(A0C8QM 8D0A(B BBBE x :38 $ EY KPM B ?. z. IU 0!dFAA J  DABJ P0! FMM B(A0H8N 8D0A(B BBBG !;P!(FMP P(A0A8N 8A0A(B BBBG !s"qP4"# CFMM I(A0A8N 8D0A(B BBBH $"e$|#,ELL FJ4#FGD A(N0g(A ABB4#FGK I(D0Y(A ABBH$XFKB B(A0A8G`d 8A0A(B BBBD `$E Q H$\7FSE B(I0H8KPs 8A0A(B BBBG H$PFSE B(I0H8KPs 8A0A(B BBBG %$jEVH4%x\FNB J(A0A8D@ 8A0A(B BBBA H%FKB B(A0H8GPV8A0A(B BBBH%)FBB B(A0A8DPK 8A0A(B BBBI D&FBB B(A0A8D@o8A0A(B BBB<`&UFI M(H0V(A BBBJ&l &h&t<&FBE D(DPc (A BBBA P&"[P<' P',d'8 x'4 '0GHs E FL&`FNI B(A0A8G 8A0A(B BBBA 0' ( 4( H(GHs E Fh(4GHs E F(dEH(FKB B(A0A8Gw8A0A(B BBBL(<FBB B(A0A8G 8A0A(B BBBD @)2HiX)#(l) }EHD K AAA )EF R AB ))lF J L) FEA A(D@ (D ABBD T (A ABBF @*8T*FIA M(D@K (D ABBK *<Hd*x FGE B(A0A8M 8A0A(B BBBA > 8H0A(B BBBE  +q@ +\FAF p KDL ~ FBB D ABI 4d+FDF0] FBK T ABI +p+ <+[FEA A(I (A ABBG 88+EU W C .f. t+= 0+#FLT DBI +,,h(DX D Z F ^ B P H \P,) LFNE B(A0A8N z 8D0A(B BBBF l,&5c T,4KFBB B(A0A8G L(A 8D0A(B BBBA ,!>(8 -<"FMH GY  DBBE H-0h-h?FLX  DBG -c0-DFLY DBF -*0.hJSFLQ DBC <.fHX.xORFJG B(A0G 0D(B BBBG .6YAP.U AFNE B(A0A8N g 8D0A(B BBBA $/^6RA @D/`6FML A(NP (D ABBI /(!8/xeFJH GE  DBBD /)00jFIL: DBE 808T0nEY P; G .\. 0W 00vFLN DBB 0p(1l{RECG c AAA 1{iEw D hPP1{FQB B(A0A8N 8A0A(B BBBD 1ZL2XFQB B(A0A8N 8A0A(B BBBE L2OBEE E(A0A8Dp8 8D0A(B BBBD h2qOp82ER Pm D .d. 2`& 42tEO U H .d. $3*= PH3FQI B(A0A8N J 8D0A(B BBBG 3p H3TFQI A(H0N~ 0D(A BBBH 4"5L40FEA A(D@ (D ABBD T (A ABBF 84ЦFMH G*  DBBD 4<P4tBLI E(A0H8N 8D0A(B BBBH 05H 6 !46(!H6D!45`A\ W&.pc. E 5_ 66 6H ^ J T A 78H ^ J T A H(7#FBB B(A0G8D` 8A0A(B BBBH ,t7FAA  ABI 47FBA | BBG mKPX7FBB B(A0A8DpxVRxDpi 8A0A(B BBBG @l7DiEC h K .{.Q.d. {.$7Z< 88xFNJ L(]0P (F BBBM 8 YAz E H8PBSM B(H0H8gP-8F0A(B BBBH9{AG H fdh9FMB B(A0A8L@ 8C0H(G BBBO  8F0A(B BBBJ 9\498EAN  AAE | FAM h:FBB B(A0D8GP,XF`IhGpOPOXM`HXAP 8F0H(D BBBL :D+EZ(:XXFHD BAB:4:rFKD F(D0L(A ABB<;FBB A(G0a (H DBBM H\;DFBB B(A0A8GP$8A0A(B BBBD;FII I(A0K8F@8A0A(B BBB4;LrFKD F(D0L(A ABB((<ZFHD DABHT<OFBB E(A0C8GP7 8F0A(B BBBE 8<FNO H(C0(A BBB<<`MHD nHBo AABH=FNJ B(A0A8DPg 8A0A(B BBBA 8h=DFKA A(G0} (C ABBI H=FBB B(A0A8DP3 8A0A(B BBBA =,6Ee, >PFJA } ABG <>=EwX>$BBB B(D0A8FPV 8D0D(G IDBI N 8H0A(B BBBI  8H0A(B BBBF  8I0D(E IGDE t 8H0A(B BBBK 0?t FDG U LKS ]GG0FBB B(D0A8NP= 8A0A(B BBBJ @ 8M0A(B BBBJ pA8FDB B(A0D8DHVL] 8A0A(B BBBK XFEHKxA FLH E(K0G8KHGPJHA@V 8G0A(B BBBL S 8A0A(B BBBC \ 8A0A(B BBBJ W 8H0A(B BBBH  8H0A(B BBBH |0B#? FBB B(A0C8G`hDpNhA`whdpHhA` 8M0A(B BBBK D 8A0A(B BBBB HBl0FME B(A0A8KPS8A0A(B BBBDB1$FKB B(A0A8GP8A0A(B BBBDC2EH`C5FNB J(A0C8K 8A0A(B BBBC C73FLB B(A0A8D^ EHE 8J0A(B BBBG 9IIA 8A0A(B BBBG  8M0A(B BBBE HTDjFBA D(D0b (A ABBG D(H ABBDLkOER I jHD|kzFBB L(L0A8F`R 8A0A(B BBBK ` El+BKL E(A0F (A BBBD  (A BBBH A (I BBBH HpE|n$BBE E(D0C8Fp 8A0A(B BBBC LE`o1RIB I(H0D8K@8A0A(B BBBED FPpFOO B(H0A8FP8A0A(B BBB<TF(qFMB H(A0 (F DBBO 4Fu>BAD N  AABA LFv!FFB B(A0A8D 8A0A(B BBBD PGpx_BBB B(A0A8G I 5 8A0A(B BBBA @pG|yFED A(K0@8F@c(A ABBF0LGy RDB B(A0K8FP8A0A(B BBBHHPI 8D0A(B BBBE O 8H0A(B BBBE ` 8H0A(B BBBE w 8K0D(G DBBE [ 8D0A(B BBBE  8K0D(G DBBE f 8F0A(B BBBE 8H0A(B BBBIFFB B(A0D8GQA`E_G]BEAEL^ 8A0A(B BBBC ^]AL^MAHIFBB B(D0D8DP 8F0A(B BBBB TIȈFFB A(D0GHZA^ 0A(A BBBA LJ@'HUHdJX-FBB E(D0A8Dp 8F0A(B BBBF hJ<FEE B(A0A8D_QGJIMX 8F0A(B BBBE HK`#FBB B(D0D8Dp3 8F0A(B BBBF hKD(BBI B(A0A8G PORHHKHPLBBBQTVABBlA 8A0A(B BBBE L FBB B(A0A8Gz 8A0A(B BBBG aOOORVJAAQv 8A0A(B BBBE XL BBB B(A0A8DpnxH\xApZ 8A0A(B BBBA M| Mx(MtaKi L \HM H\MFFE B(A0A8GPA 8A0A(B BBBI $M7EHG `AA(MIIDJ hAAG(M@AICK eAAB((NdAICK eAAB(TNIIDJ hAAG$N7EEG cAA$N7EHG `AA$N7EHG `AA(NIIDJ hAAG$$OOEAG AA$LO@7EEG cAA(tOXAIDL cAAB(O|AIDL cAAB$O7EEG cAA$O7EHG `AA(PAIDL cAAB$HP7EEG cAA$pP 7EHG `AA$P$7EHG `AA$P<7EHG `AA$PT7EHG `AA$Ql7EHG `AA$8Q7EHG `AA$`Q7EHG `AA$Q7EHG `AA$Q7EHG `AA$Q7EHG `AA(RIIDJ hAAG$,R 7EHG `AA$TR87EHG `AA$|RP7EHG `AA$Rh7EHG `AA$R7EHG `AA$R7EHG `AA$S7EHG `AA(DSAJDL bAAB(pSAIDL cAAB$S7EHG `AA$S(7EHG `AA$S@7EHG `AA$TX7EHG `AA$FBB B(A0D8DP8D0A(B BBBH]?UFBB B(A0D8DP.8D0A(B BBBL<^AFBB B(A0C8G 8A0A(B BBBH H^GnFBB B(A0A8JD8D0A(B BBBL^KFEB B(A0A8G 8A0A(B BBBA H(_$R-FBB B(A0A8J8D0A(B BBB8t_W'FIA A(G0(D ABB\_WFIB B(A0C8KIkAy 8A0A(B BBBA L` 8A0A(B BBBF   H K  E T L S Z A `FBB B(A0A8Gpq 8A0A(B BBBH N8J0F(B BBBH0FBB E(A0A8Dp  8A0A(B BBBG (|@5FBD bDBLT2BEE B(A0A8O 8D0A(B BBBD DDBFB A(A0D 0A(A BBBJ ,@sFS W(D0F(A m EA `p)FBE A(A0 (D BBBF W (D BBBG L (D BBBA H` A 8FBA C(G (D ABBI P`0r 4FNL E(A0A8N 8D0A(B BBBE rIi4P8FBB B(A0A8G I!  8D0A(B BBBH \FBJ E(D0C8GGlF 8D0A(B BBBH 8XTFBA G I   ABBA ,FAG I  DBA EPp AK (FADp DBD HxFAA G I  R H A Z  DABA `FBB E(A0A8J3 8D0A(B BBBE \Av_GcWBnWA NaD@(FBJ D(A0F 0A(A BBBE L8 .FME B(A0A8G 8D0A(B BBBJ @FME A(A0G 0D(A BBBF 0!%1FBB B(A0A8H Q G7 8D0A(B BBBA }TcB,JPG$E?0L|04FBB B(A0A8G L" 8A0A(B BBBF 07FLD G  DABG P9 FBB B(A0A8G L+! 8D0A(B BBBA pThDFFB I(D0C8G  J Q E  8A0A(B BBBJ  L q A <]FBA A(G L" (D ABBB P<$aqS/FBB B(A0A8G L* 8D0A(B BBBH C/*8,g.FBA G L"  DBBF C."8j[.FBA G L!  DBBE L^C.!Tlm .FBB B(A0A8G L-. 8D0A(B BBBD B?.-4hzOLP L fK L([0oUN wA{KH{FBB B(D0A8GpT8G0A(B BBB@L}FIB D(C0D 0A(A BBBA 0}FAD G0i  DABA <}FBD A(GE (A ABBA |XLFBB E(L0H8NaBPAUI_AQ^CEIB 8A0A(B BBBA H(bFEE B(D0A8Gp' 8A0A(B BBBA HLbFEE B(D0A8Gp' 8A0A(B BBBA @pAFEB D(C0LP 0A(A BBBB @`|AFEB D(C0LP 0A(A BBBC XFGB B(A0A8JP 8D0A(B BBBD DXS`FhDpSP(,ECFp AAA L,0FFB B(A0A8Dp 8A0A(B BBBH @![*BBA A(G I  (A ABBE >** $(*EJ AB <>)($xEF@PkHH@` DD PPl9FBD J`XA^  ABBJ D`MA8XFBI D(J (A BBBE @\$)FJQ H(G (D BBBG X=1 )AHH` I dH`q G @FBB D(A0D@ 0D(A BBBA HhFBB E(A0A8DP 8D0A(B BBBJ 4[FDA G"  AABH HDH`z F d(H` I <FED A(G (A ABBE 8FED D(Gp (A ABBC 4 FDF0] KGI T ABA @hA'E\ W .p. G t.p|. ;' LFKB J(A0D8I A 8D0A(B BBBG DPBMI A(P8B@BHBPI0 (D ABBA 4qFBB B(A0A8G L'X 8D0A(B BBBJ 'U'E'A'I'P'I'P'A'I'S'M'P'J'Y'D'M'P'I'M'P|%FNI B(A0A8G 8A0A(B BBBA h\:%8v%EH DPLGB .b. D :7% PU%FNI B(A0A8G 8A0A(B BBBA @9n%<dR%EH BLPLH~ C f.b. 9X% h@PBB D(D0G 0A(A BBBA dMFBB B(A0A8G 8A0A(B BBBH K 8O0A(B BBBE ThLh4FMH E(A0A8G 8A0A(B BBBG \iFBE B(A0K8G 8A0A(B BBBH `ZRD,a,@ EAG I  AAA (pEAGp AAA FBB B(A0A8GY 8A0A(B BBBH |nKDxfB UG peAE ZN <pO$PEG I  AA PxgFBB B(A0A8G L" 8A0A(B BBBJ FBH E(A0A8D` 8A0A(B BBBA 1 8A0A(B BBBE R 8A0A(B BBBD ] 8A0A(B BBBE HdFBB B(A0A8DP  8A0A(B BBBJ L"=FDE M(A0A8G 8A0A(B BBBG  6PHC*>  I    )bbbabb b;b?bXbZyb[b\b\b]b]b].b^b^ob`b`Vbabab 9B4s96 +       $A    D   L    D $  q @= J 72*P% $  *q%B            /#+$+$+       $M   ,           1 z %      1B   $         A% *O%C    %      $ >N    %          H +       $%   L   ~           2 R              4";  @  +       $+       $+       $B         a   ,$    | % $#  =  >  *@  C        M    $#######$#$$$#$$$#$$$ $!#!#"$"%"$""$R<$ $53 !$57 !$-@ !$ % ~/ !*   -   ) 3'H    %        ,'7   5    /   !<   ,       L   C          %  %     !+  %      %%$$-p !SF A $5 $7 0  $ .     2 2 Y]$ 3     @6 $   P    >  %8 '%A '%A  $   " @@        %7r`49; 1%r    $si# B0    %]%  $ * ^  w  *H 6$    g    6,'G   o  N                 O  E           /a     6/"   Q  :  /  $ 5       $  4  y !#    O      R';%?IU    9T   H           !*MT   );O M        m      3! //-//...-///$/-.--&.&-&/&/&.'.(.(f-).)u-*.+-+-+.,/,-,,-'BRb6(      |C6  *< J ^ l                                T w x-  c  6 k7 h: % -%- e   6   %     > i>              +^)"K^KT^X $ @  5         $ 3 S 0  r   S  # M    $  V  2     <&  %  ^ B BC"B4C9B?C?B?mCA4BACBBBCBB%     $  - m.+ P %$%L$$$$#$$###$!$!$z(q9cM%      y )$     i%$%%%$%%% % $!%#6$$%$$$$$% F!OA @Pgb@ 'X@u;N@.z&D@@v:k :@:1_0@5m&@ yq(k@ ݼ$@@ԕP`X(;)PٲX 7Pͱh`@èƨ%ɨ̨1qϨ5Ҩըa42( xIIIJhJJHKK LPL` LL@MMMN KW ctzӎƊيǰe"<<Q;Q |+    ڋƊيǰe"<#Q; i    ڋˌڌƊيǰ ܹ   'XAOfu̺Űx}JOOHHNNTTZZ``ffllrrxx~~``>)B6BCBPB]BkByBBBBBBBBBBCCC,C9CFCSC`CmCzCCCCCCCCCCC DD#D1D?DND]DkDyDDDDDDDDDDD EE%E2E>EJEVEbEnEzEEEEEEEEEEEFFF(F4F@FLFXFdFpF|FFFFFFFFGG#G4GDGPG\GhGtGGGGGGGGGGGHH'H8HIHZHkH{HHH *E_A)v0(o;ssssst.tHt_t{tt)tttttu,uCu\uuuuuuuuvvЧ1v HpEvZvrvvvvvvvw"w3w9wSwgwww0XЩww ww xx/xCxXxmxxxxxxxxyy-yAyUyky~yyyyyyyzzz1zAzSzezvzzzzzz {{*{>{Q{zc{zzu{{{{ 3DTfwó=h*#9Oey)*-Jb~** 7P\hu p (8o( t P"CG ooEooBos 0p@pPp`pppppppppppqq q0q@qPq`qpqqqqqqqqqrr r0r@rPr`rprrrrrrrrrss s0s@sPs`spssssssssstt t0t@tPt`tptttttttttuu u0u@uPu`upuuuuuuuuuvv v0v@vPv`vpvvvvvvvvvww w0w@wPw`wpwwwwwwwwwxx x0x@xPx`xpxxxxxxxxxyy y0y@yPy`ypyyyyyyyyyzz z0z@zPz`zpzzzzzzzzz{{ {0{@{P{`{p{{{{{{{{{|| |0|@|P|`|p|||||||||}} }0}@}P}`}p}}}}}}}}}~~ ~0~@~P~`~p~~~~~~~~~ 0@P`p 0@P`pЀ 0@P`pЁ 0@P`pЂ 0@P`pЃ 0@P`pЄ 0@P`pЅ 0@P`pІ 0`PpPPP` 0ppp @p   ` ``` E @бPp P`P @@P 0?@`Gp@F@0? PQP@Mp\Pp`pf@` @k `pep!6),-`F+$GJ0 0/`"'%00I p     @e:0A``P0P`r  p jpPjP_:zl0gâj Ij8Ǣj̢ kp֢hkߢk0 _X+70OOkE`k=o|= =2 l,ţHlУpl`ݴ@lЍlzmu!+pHGWCQlFHmJhm`m`Ťm nmp n@?HnҤxnؤn`Pnݤo8o hoPoo`+p%.0p <hplJpVp eqP3q< XqPZqRq W#:qphHPvХrqPrrДr2+r9 s0"8Xs0(JskYsegsav(t]XtVtPt Jɦt@Eݦ0u@) Xu-zC@7)3Ou@cjP<@u<uv@vxvv0vwHw˧w ӧwۧw` xXx`x`xP y05hy`?yKy0U(z$Xz@]zzCo@({`44`4@4 443333`3@3 332222`2@2 221111`1@1 110000`0@0 00////`/@/ //....`.@. ..----`-@- --,,,,`,@, ,,++++`+@+ ++****`*@* **))))`)@) ))((((`(@( ((''''`'4 8@بX{ 8*E_1$v0  0 1  ه1h1@1115"Rpxo22dd,,XX  I^ I^ I^2I^2dI^dI^,I^,I^I^XI^XI^ I^ I^I^((()8)X)*BPn6F.Yj  )(9MUnx))()X)8))*)*@*h***:Ol*+B((FY0+P+Yjh"p++ `ФXpmyvMDummy PlaceholderArbitrationPowerMgmntLbaRangeTypeTempThresholdErrorRecoveryVolatileWriteCacheNumOfQueuesInterruptCoalesing InterruptVectorConfig WriteAtomicity AsynEventConfig AutonomousPowerState00xe30xc0zkHzezzpz{{{{{~{{{||7|B|^|l||||p||Ȫ|||}}H }x(}2}J}c}H^|l||||p|x}x}}}}H }x(}}}}}}}}}d~~ ~~{{||7|B|~&~5~@A~@|pN~b~xs~~~}}H~~~7|B|~~~~ {{||7|B|5-AAKVbȭq8`8`):?PnMbv&=E@6F?@Z@Y+ `E*#82E0X"7LavHVdE+ xr  3Jax4Ld|#5HZm+>ReyP@  !E/0i`!E/0h@ % ; @ ` 0 ! 3 ` Э  P "%(,06  6pp 77 %7 97X` O7k7` 77 77[ 7X0 8&8P D8b8@a 88 88] 8Y Y;@Y ';hY C9Y` 9YP (9YPS =9Z0 y8Zh W9s9P3 p;9 =hZP 9Z 99 u9 zZ 9Z ݴ[ 98[@ n`[0$ )[` %'[@{ n[0 :\F 3)H\ :": { <:F:B ]:i:z ::z ::{ mx\ \r C\`! 0]@ 9p]# W9]@9 :]@ :]m ::` ;^ - #;8^ <;h^ U;^p l;^Л ;;Y ;; ; ; <k &<4<`` G<X<p r<< <^` ^_ <<`/ =9< <= .=;=@ L=^= t== ==0 9P_ == == I y >> &>4>`c F>L>a CV>` n>}>[ >>Z >>PV >>< >x_ >_ ?? -?9?к 9` yP?м =a? |?(Ю ??@ &<?0 ?` r<? <a =9@a aa @@ 1@a F@Q@ e@bp yy@` =0b 9@P Co@ Cpb0 @b @b 9b` ;c@;0c=9`c <cЄ yc @dЙ @8dP 9hdЏ ;d H =dk @dV ; e@ APe@P Ae4 8!A " #:/AP. 9=A) $9UA0% 7e@ qAe0 9(f@Co0{AA@AAAPftAxf8=9 `D=AWAfp3AfeBfp=<B,r<?@6;3B ;3B &<OB@RjB{B`=B^ g\yB 9BpI;Xg;g@FBB& CgCg.C  @CgpRC(hdCXhtCCZChpզCPChqAhBBCiWC0i9Xh?Xi z9i}CixCi Dj qAHj0yjCo^!Djd1D;D0JDWD@_CeD]jDD4DkT0kH@D@FDhkB`D>9k8Co9kCo hhgggg`g@g ggffff`f@f ffeeee`e@ehhhh`h@hijjjj`j@j jjiiii`i@i iko`o@o oonnnn`n@n nnmmmm`m@m mmllll`l@l llkkkk`k@k koopo`p@p p`r@r rrqqqq`q@q qqpppprrrr`t@t ttssss`s@s ssu`u@u uuttttuuuv`x@x xxwwww`w@w wwvvvv`v@v v@z zzyyyy`y@y yyxxxx@{ {{zzzz`z`{{{{{|||`|@| |||} }@}DD E`}Ej@~$Ekj~*E.Ej~JElj OE lSE@ZEPljpbExljlEtEjElEEljEljEmj@E@mjEhmjEjEmjEmjEmjEnjPE0nj`EXnjEnjFnjFnj FnjFojnvme-2.11-5.el9.x86_64.debug: 'Nlhci^:wEN֗PKIhkw (;|WJvh 3qse6JwNEqceꂻ3!TQJx,(^$v?9ZwĬDU*@/i-Z> ~lR:ϏU;_OgUp3k3&35vg|vV,+sQ'Nڐ)}Z˪d%U)G!ߖol S/6hU{wrD#{z(gy2!07/o&H37V=NCz4X#uomV,+֨~0hd؞bIr{ҰsA8* n0s(I\ǟȠ ȌQ+jQkGY M4&8mȘΛߩv.\d? O4O ,{(x}sӝ @ Z@pJc?L4F7luM1fhzCC_l1)#n@${d\{By4O,DpǐCa0X 2݂!{[#5,2 ګzgeYEN[(x Pi:.{ \~n;DVoL z*5}ex+gO<=q÷Z\.=Ȣw9Qw\|Wjr=7|x&V~+35X}-|xv!M F+4xJv<YԜsQZRSA5",DhJL'Mi9} @DDX1|s5W{ָw@gVC@R[#8ʟj)LhnϳPRiЊaI }NQ4lEgE&.bvZذO&tn3X'(Z,be2cke"WS*ȝ[|ڝ&N2EfGuuFuD6d%3K𲦇֘2^ Md8DkY,6 H걖/΢ eB $åѥ ɍu $tBHm2i7ZL):q*%gC0. ;V+8B'h=Sw f_F,}sC7/=x(߶nsQy&|SeCU iSNp:O;M`t25dxdjuA*@jH/{XkԶ3^ۚ^ؗ].h05Wj!-\q:wSe;6j 1)ֳo?b)iC1!sgK-^C~=xϗc,Țr-\&IDuDp';g:{CpwH֘dpݎc&2rWv`*_\vEHI+'0p~,.k0P0f()Ω{)o:lDz4Udk:ЂOjwYT8D/ٔ0"i"q7@HR7N.GG,FjHyDl ']&5@u vAi< :_>@M qGc~J&Szz#K^ z®|ΫRjV,ϭUKDf&1)AfZFtHήgU VF 7vMf \m=$_r$3ZoXä$XgU&rGˇW%E!Qzt@? aζ*mj y{n#t/:}v Á%`-h{{a k|z_X ; cFݎ^Bg?SߖFV|}c2>bd5 (N=3XYk,u8-]EFb@oƒ {'fǀj$$Pt?aa/@TP{Qeq1eU abaiaMăYfG T'0" n\_qawc~J REU&64"m1i uUùꁟ5In .d2YfU81EW>b z vcl,%lZM$qj'<do,7v;Aw֣otw QpdG'6UM6Q/x!-C Ő3M/^'Fկdp9S$˒$J;4?~D uށ7̸jq3r}:wmZ'Vws:ثyCs6{>Nc}Ou#bh둀ꖎJPbs Z*_C/y]3VHphOlib¾)<oMA{?СdԽW5?$!EPHs kv tiI-G O: &$dSfz kK/؛["t^| #m8kD{`Hjw MEg֫VG3kbHboqh-'TG~ӄ9P*4 +b)/52&*$v><+ iZ)/M&=}$q T\0oԮaɩz` ;&K٘X #l623; qRe1s1|Kґ\ȱ0{=(SC[Xㅍ}G1$ pYx5Vbi}a,9jNS>|a]&s>e-㽙+dC^"wS,,7UﲄBMy"p#qa | Y)Sq| K])] B.AJ@#l6Ej*jD#N.Fe8Hro,)?N$UWaE <.tU>5Jsr12 RGSʚ@*S9R0.N^]%X:mE4qJhs@=;_>@(7smby.Ov`e9Ps a3jIl Ij!2Y3a1*!nkVMH:^%\ D/o|롅m0{a6m9? YaeK6_1}fzV[qnS=,ZH^4S)|0}5r}c~zUQ{/tL0t2ҧϤ0C(.JHt}T\"dgy#*hdQQtI"AlFy΄> zVP9>_Xu_)|ԑ~ZOY&EW{1riw`j('Z =}+[(E"߮2 %w'ϋ\ Yţ}Bҙ# $k]؃=}/h$wTS{]!)"-Sۨ0;*?adIlhh%=j_~yBtFhR:o ˒~mt eKyX1xu V1MK%[= IH[i#ڶ.8ٲ@#J}Y,ОM NMb"f7dd_%:JX~f3W3WH 7GIpr1dQY Žm[5 /;6}\A= I2;J)g{ߍցoƚRO%XGb'>b.yȠy^u9 y,vht&+\/U%ts}q#<ک}KlGl8#b3\eu|gk6HYw/#5Xޙ\V_x@}yї\q[|z` +"Xѕ\scwm2g`5x胲ZFs-,lqf@`zV`R.7D;DI%n[Nga7MK `qpƽ8DE[_!*Z_0荕۪ ]UT@l*<+:w2PT ZlXSY4,v,´)c>j9HDY]@]v׻k;j/m̫~ZOkbhj y{]H%Eak-M' ?y1lz:fO%.26ވNl7o%}cQu/ҸlwF:7[Ӥ98g/#$|pKPmrXXx˼ȋH=x3 š-* /=e=˩ѓF>GBҹJ”S;Qr M 8]H]Cx&.5 _KQLs GؔWb 4}XXܯ'N6I?hH6|SC+FoZonV D4&LJ `B .랜jcX)l߾"ۆE*=Q.e{2!Ѝ.c#vr Ϣ=?̕!}OT.;yqti7 ӃG 밶U&X5#v|W2al|瓭CIh&m{~se@lf˳6!+*VCܹƗcR e:M x0~Tmu܋[滰[ڞ+0pkH q VR$T"[0[1b-T ~L20nۭ8M"'Fm32;@sq+@ZL/kB}$b)5)JQ9-7Fδ1%WiÊ.hshY)Iik`/O5xl y׵XCrN"} s2n*5F=O"<aoq]}ZcS!OLV;tw$Ѫ_k Pjr9܀֪5<6ÏX㔶aS+OGnLXPϑKMY^0599A)(H 4Bgv)oqGZy%D~% ~>wWaA4I=9A/b[L%̼;UN9o%~3m-H:mww{z9^)Jܔ,2!&rWɲM0 $,gGίuƍHKK̞f3@C_0os+P g+^'6KeC\@>I$TkL=>*WQ2ًa (½)iAݗ%TGIح-9(Vķ,s5och?}R.£Y6Ũp/YY:bc}Jo0-8aMCYxYx u pF#\%؃>#ʍ_,U'5N*XDd+Sp./.^tP@RA󙫣Wtakm #9ew2 1YO8pH|diD/I}ђh`ӱ5Cukm%h'^˛^ yUeOHtgLmV0gVop@{9rXnVG"߷"e 3j/˭U&@mYՀw eb:,:&,ר9kJhw?x*wBIڥ+-a\7;QKggHxq0|\Rh M?!}FNʹ'3̐@rGY޻Ź@b^% ɇ,❛ٕko'K^hy76gp< ;x$Yh u'jڏxdov_omi@T t[0n=KU`t; +`?+r;HK_Dpy3LoUDg𗓵 +1佼Zsx .q'H{SC~O\]LT|oJ/,;;#t^3&NA@ EpI8݈Rg>2,؅cK՜+ 0KΨ+V?!.,|=;b7e/>9}_L;t݉!ъgqc>,q1~5 U{0K ǎ߸+RyZ#i3[MUXs=xuWGFIkk[2E;xG߷ȍ7&MX U:^ d/%QYWo!o?jRci6^دjA iS߻ˣdZړ|1/;h=0zQA.5Z5u"l.03a#?hIN.*z *7THvq{HnFۄ%-ɏCfIJ#2j`z3qSEyMtSC[^xSॾW?3 \5̀Rp9G3o4 O.<#g`Iu/)`c_ I83&{"EZ`%`{0uT_83ji(0Jjm]>CT"arFҧEgHo-O5"x1_;ucxT6E1% o&lZm0OK%`g)\g{/\]İr.Ho@yW{{'R._~ㆈkp#HI^ J̳ID=y"/vҝB! P Y'=41S u9C-'s)6RrcȇM(nAfnHB)wڏ;È}L X^-94ʕĠ-RXyo!P>ſi4c `ge5V΅P ^R  3`^ռRp&|r,5BYTo|QAu=Te"ԔIJHSu#_8_f'U.=no#BE8絼Yf eEWua7ae=Wlҟ$*7:&oJ ukW\CH ĺ5o1uk"Ҽa8w?u8l7*$q!:bkv_`ZzqSIp炾҄ kfL"&5X>)OML쟮S Z^^chޣZJ11`=>=B;>]5-#;nOطEbs{NBp %Nt̴NFQg22rzNGc{ O !)= n7Xΐɔ_!ȟwCd,rpޗ)kHX>͟gۿٙ e"rNNHn Ik-C_^L A͈9lX74ԧ&e|r}G Wd v_v%f:6]06Ɩ6JYleQI6ټ=J7 ']lR?l3*oh^?/iX&@n\c}Y9Ggf|^{l@HW]IE₺Pe=\\.{O&7~IH4e*URD;ck䄉f;jU$i2\@g` ?(Y ՟ޘ Q?"kLEܖ}F":$dӜY%U){ʞ\Cmù . v'w*'xRPrĊK<=j+ifI''WR[dJ{J  X4}u!ո3H?L8kͮd^5^W?*trd `{ UcXվ4/= ˆϢJn6:,apN fO:*FXk{9J5_`?.*=1?'rfʒ|,}v%*unwu'kLN<('3O B tQ`L|F" Kl;̊t$fқ) 4X[~SgWIK˽AW% -0Nu'<+TvCtD_v0KnD2+ds# yWlͪ:B )Zvͧ]Pf <2 j]-Vd5.bvkb/ iZ~7h(4ܛQsOl|vMH[G%>^( EgF!С7QH5{ N#˼m3fklKo)nH&`\!T|"VߘD%L&Dh`yc-̾j(Ua],+FAP@k;]Cmj3۽r6$[\m]mfnRPf^\6ɉdk褾~m2d\Bro|'J]d ӲM